Property Summary

NCBI Gene PubMed Count 25
PubMed Score 90.15
PubTator Score 127.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.700 1.8e-04

Protein-protein Interaction (3)

MLP Assay (9)

AID Type Active / Inconclusive / Inactive Description
1209 confirmatory 814 / 0 / 193412 HTS identification of compounds inhibiting phosphomannose isomerase (PMI) via a fluorescence intensity assay.
1214 screening 11 / 0 / 194215 HTS identification of compounds activating phosphomannose isomerase (PMI) via a fluorescence intensity assay.
1216 screening 656 / 0 / 193570 HTS identification of compounds activating phosphomannose isomerase (PMI) via a fluorescence intensity assay using a near- saturating concentration of mannose 6-phosphat
1220 confirmatory 1288 / 0 / 192938 HTS identification of compounds inhibiting phosphomannose isomerase (PMI) via a fluorescence intensity assay using a high concentration of mannose 6-phosphate
1535 confirmatory 129 / 0 / 73 Confirmation of compounds inhibiting phosphomannose isomerase (PMI) via a fluorescence intensity assay.
1536 confirmatory 4 / 0 / 12 Confirmation of compounds inhibiting phosphomannose isomerase (PMI) via a fluorescence intensity assay using a high concentration of mannose 6-phosphate.
1545 summary 2 / 0 / 0 Summary - Compounds inhibiting phosphomannose isomerase (PMI) via a fluorescence intensity assay.
1553 other 34 / 0 / 56 Screening for Phosphomannose Isomerase inhibitors in cellular based assay using Hela cells.
1620 other 51 / 0 / 39 Toxicity Screening of PMI Inhibitors in Hela cells

Gene RIF (4)

PMID Text
22082156 Knockdown of mannose phosphate isomerase (MPI) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
21949237 Phosphomannose isomerase inhibitors improve N-glycosylation in selected phosphomannomutase-deficient fibroblasts
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
16488169 The mannose-6-phosphate-enzyme complex is developed and the key residues involved in the ligand binding are determined. Our results suggest a hydride transfer mechanism of alpha-hydrogen between the C1 and C2 positions.

AA Sequence

MAAPRVFPLSCAVQQYAWGKMGSNSEVARLLASSDPLAQIAEDKPYAELWMGTHPRGDAKILDNRISQKT      1 - 70
LSQWIAENQDSLGSKVKDTFNGNLPFLFKVLSVETPLSIQAHPNKELAEKLHLQAPQHYPDANHKPEMAI     71 - 140
ALTPFQGLCGFRPVEEIVTFLKKVPEFQFLIGDEAATHLKQTMSHDSQAVASSLQSCFSHLMKSEKKVVV    141 - 210
EQLNLLVKRISQQAAAGNNMEDIFGELLLQLHQQYPGDIGCFAIYFLNLLTLKPGEAMFLEANVPHAYLK    211 - 280
GDCVECMACSDNTVRAGLTPKFIDVPTLCEMLSYTPSSSKDRLFLPTRSQEDPYLSIYDPPVPDFTIMKT    281 - 350
EVPGSVTEYKVLALDSASILLMVQGTVIASTPTTQTPIPLQRGGVLFIGANESVSLKLTEPKDLLIFRAC    351 - 420
CLL                                                                       421 - 423
//

Text Mined References (27)

PMID Year Title
24407290 2014 The metabolic origins of mannose in glycoproteins.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21949237 2011 Phosphomannose isomerase inhibitors improve N-glycosylation in selected phosphomannomutase-deficient fibroblasts.
21269460 2011 Initial characterization of the human central proteome.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16488169 2006 Computational study of human phosphomannose isomerase: Insights from homology modeling and molecular dynamics simulation of enzyme bound substrate.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12414827 2002 Protein losing enteropathy-hepatic fibrosis syndrome in Saguenay-Lac St-Jean, Quebec is a congenital disorder of glycosylation type Ib.
12357336 2002 DHPLC analysis as a platform for molecular diagnosis of congenital disorders of glycosylation (CDG).
12122025 2002 Molecular cloning, gene organization, and expression of mouse Mpi encoding phosphomannose isomerase.
11350186 2001 Genetic and metabolic analysis of the first adult with congenital disorder of glycosylation type Ib: long-term outcome and effects of mannose supplementation.
11134235 2001 A broad spectrum of clinical presentations in congenital disorders of glycosylation I: a series of 26 cases.
10980531 2000 Genomic organization of the human phosphomannose isomerase (MPI) gene and mutation analysis in patients with congenital disorders of glycosylation type Ib (CDG-Ib).
9585601 1998 Phosphomannose isomerase deficiency: a carbohydrate-deficient glycoprotein syndrome with hepatic-intestinal presentation.
9525984 1998 Carbohydrate-deficient glycoprotein syndrome type Ib. Phosphomannose isomerase deficiency and mannose therapy.
9451038 1998 Direct utilization of mannose for mammalian glycoprotein biosynthesis.
8307007 1994 Purification, cDNA cloning and heterologous expression of human phosphomannose isomerase.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
1222586 1975 Confirmation of the synteny of the human genes for mannose phosphate isomerase and pyruvate kinase and of their assignment to chromosome 15.
341373 1977 Assignment of the structural genes for the alpha subunit of hexosaminidase A, mannosephosphate isomerase, and pyruvate kinase to the region q22-qter of human chromosome 15.