Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.31
PubTator Score 8.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
hepatocellular carcinoma -1.400 3.3e-04
psoriasis 2.000 1.4e-137
osteosarcoma -1.242 2.9e-02
atypical teratoid / rhabdoid tumor -1.400 1.6e-04
medulloblastoma -1.300 3.7e-04
medulloblastoma, large-cell -1.400 2.1e-03
intraductal papillary-mucinous neoplasm ... 1.500 3.6e-03
lung cancer 1.600 2.9e-05
ductal carcinoma in situ 1.600 3.9e-03
invasive ductal carcinoma 1.100 1.7e-02
ovarian cancer -1.400 4.4e-09

Gene RIF (4)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18187620 Knockdown of M-phase phosphoprotein 6 (MPHOSPH6) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
16396833 MPP6 is a nucleolus-specific exosome co-factor required for its role in the maturation of 5.8S rRNA.
11719186 MPP6 was found to be associated with the exosome, a multiprotein complex involved in RNA degradation.

AA Sequence

MAAERKTRLSKNLLRMKFMQRGLDSETKKQLEEEEKKIISEEHWYLDLPELKEKESFIIEEQSFLLCEDL      1 - 70
LYGRMSFRGFNPEVEKLMLQMNAKHKAEEVEDETVELDVSDEEMARRYETLVGTIGKKFARKRDHANYEE     71 - 140
DENGDITPIKAKKMFLKPQD                                                      141 - 160
//

Text Mined References (27)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20531389 2010 Dis3-like 1: a novel exoribonuclease associated with the human exosome.
20531386 2010 The human core exosome interacts with differentially localized processive RNases: hDIS3 and hDIS3L.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17412707 2007 C1D and hMtr4p associate with the human exosome subunit PM/Scl-100 and are involved in pre-rRNA processing.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16396833 2005 MPP6 is an exosome-associated RNA-binding protein involved in 5.8S rRNA maturation.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15635413 2005 Nucleolar proteome dynamics.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11719186 2001 AU binding proteins recruit the exosome to degrade ARE-containing mRNAs.
8885239 1996 Identification of novel M phase phosphoproteins by expression cloning.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.