Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.74
PubTator Score 8.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.400 1.6e-04
ductal carcinoma in situ 1.600 3.9e-03
group 4 medulloblastoma -1.300 1.1e-04
hepatocellular carcinoma -1.400 3.3e-04
intraductal papillary-mucinous neoplasm ... 1.500 3.6e-03
invasive ductal carcinoma 1.100 1.7e-02
lung cancer 1.300 8.8e-03
medulloblastoma, large-cell -1.400 2.1e-03
osteosarcoma -1.242 2.9e-02
ovarian cancer -1.400 4.4e-09
psoriasis 1.400 2.1e-10

Gene RIF (4)

AA Sequence

MAAERKTRLSKNLLRMKFMQRGLDSETKKQLEEEEKKIISEEHWYLDLPELKEKESFIIEEQSFLLCEDL      1 - 70
LYGRMSFRGFNPEVEKLMLQMNAKHKAEEVEDETVELDVSDEEMARRYETLVGTIGKKFARKRDHANYEE     71 - 140
DENGDITPIKAKKMFLKPQD                                                      141 - 160
//

Text Mined References (28)

PMID Year Title