Property Summary

NCBI Gene PubMed Count 26
PubMed Score 32.02
PubTator Score 17.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (5)

Gene RIF (5)

AA Sequence

MAAEADGPLKRLLVPILLPEKCYDQLFVQWDLLHVPCLKILLSKGLGLGIVAGSLLVKLPQVFKILGAKS      1 - 70
AEGLSLQSVMLELVALTGTMVYSITNNFPFSSWGEALFLMLQTITICFLVMHYRGQTVKGVAFLACYGLV     71 - 140
LLVLLSPLTPLTVVTLLQASNVPAVVVGRLLQAATNYHNGHTGQLSAITVFLLFGGSLARIFTSIQETGD    141 - 210
PLMAGTFVVSSLCNGLIAAQLLFYWNAKPPHKQKKAQ                                     211 - 247
//

Text Mined References (31)

PMID Year Title