Property Summary

NCBI Gene PubMed Count 17
PubMed Score 18.40
PubTator Score 17.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Multiple myeloma 1.507 2.4e-03
astrocytic glioma -2.500 3.6e-03
ependymoma -2.400 1.1e-02
oligodendroglioma -2.000 2.0e-02
glioblastoma -2.500 1.7e-05
osteosarcoma -2.930 4.5e-08
medulloblastoma -2.500 4.8e-06
atypical teratoid / rhabdoid tumor -2.500 9.5e-08
medulloblastoma, large-cell -3.300 1.9e-07
primitive neuroectodermal tumor -1.900 5.6e-04
pancreatic ductal adenocarcinoma liver m... -2.562 4.2e-03
intraductal papillary-mucinous neoplasm ... 1.600 5.5e-03
lung cancer 1.200 1.2e-03
adult high grade glioma -2.000 4.8e-05
pilocytic astrocytoma -1.400 1.7e-05
non primary Sjogren syndrome sicca 1.100 3.4e-02
Pick disease -1.300 1.7e-03
ulcerative colitis -1.300 3.3e-05

Gene RIF (7)

PMID Text
26577410 These results reveal a novel post-translational regulation of MPC1 by Sirt3, which is important for its activity and colon cancer cell growth.
25458841 Tumor cells expressing MPC1 and MPC2 display increased mitochondrial pyruvate oxidation, with no changes in cell growth in adherent culture.
23933155 found no significant difference (P > 0.05) in either allele or genotype frequency in the SNPs between patients and controls.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19536175 Observational study of gene-disease association. (HuGE Navigator)
19064610 Observational study of gene-disease association. (HuGE Navigator)
3022128 characterization of the rat ortholog

AA Sequence

MSAAGARGLRATYHRLLDKVELMLPEKLRPLYNHPAGPRTVFFWAPIMKWGLVCAGLADMARPAEKLSTA      1 - 70
QSAVLMATGFIWSRYSLVIIPKNWSLFAVNFFVGAAGASQLFRIWRYNQELKAKAHK                  71 - 127
//

Text Mined References (20)

PMID Year Title
26577410 2015 Sirt3 binds to and deacetylates mitochondrial pyruvate carrier 1 to enhance its activity.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25458841 2014 A role for the mitochondrial pyruvate carrier as a repressor of the Warburg effect and colon cancer cell growth.
23933155 2013 Lack of association between MPC2 variants and schizophrenia in a replication study of Han Chinese.
22628558 2012 A mitochondrial pyruvate carrier required for pyruvate uptake in yeast, Drosophila, and humans.
22037555 2011 Common variants on 8p12 and 1q24.2 confer risk of schizophrenia.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
3022128 1986 Structural characterization of a heterogeneous family of rat brain mRNAs.