Property Summary

NCBI Gene PubMed Count 21
PubMed Score 7.43
PubTator Score 5.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Rheumatoid Arthritis 1.500 1.6e-02
hepatocellular carcinoma -1.700 1.8e-03
ependymoma 1.200 3.8e-02
oligodendroglioma 1.100 1.8e-02
osteosarcoma 3.584 2.2e-06
primitive neuroectodermal tumor 1.200 7.2e-04
adrenocortical carcinoma 1.350 5.4e-03
intraductal papillary-mucinous adenoma (... 1.100 3.0e-02
psoriasis -1.100 9.1e-07
Pick disease 1.600 1.7e-03
ovarian cancer -1.500 4.5e-05
pituitary cancer -1.100 2.4e-03

Gene RIF (3)

PMID Text
25796627 Suberoylanilide hydroxamic acid enhanced the expression of malignant genes such as MORF4L2 in lung cancer cells remaining after treatment, creating a more drug-resistant state.
18593893 The transcriptional status of four key genes, thymidylate synthase (TYMS), MORF-related gene X (MRGX), Bcl2-antagonist/killer (BAK), and ATPase, Cu(2+) transporting beta polypeptide (ATP7B), can accurately predict response to 5-FU.
14506250 can repress or activate the B-myb promoter depending on the cell type studied, suggesting that there may be tissue-specific functions of this protein

AA Sequence

MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSG      1 - 70
SVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEAFKNRMEVKVKIPEELKPWLVEDWDLV     71 - 140
TRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEI    141 - 210
LLAHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVAS    211 - 280
AEYHRKAL                                                                  281 - 288
//

Text Mined References (24)

PMID Year Title
25796627 2015 Enhancement of tumor initiation and expression of KCNMA1, MORF4L2 and ASPM genes in the adenocarcinoma of lung xenograft after vorinostat treatment.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18593893 2008 Single-cell transcription site activation predicts chemotherapy response in human colorectal tumors.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16230350 2005 A mammalian chromatin remodeling complex with similarities to the yeast INO80 complex.
15772651 2005 The DNA sequence of the human X chromosome.
15647280 2005 The mammalian YL1 protein is a shared subunit of the TRRAP/TIP60 histone acetyltransferase and SRCAP complexes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14506250 2003 MRGX is a novel transcriptional regulator that exhibits activation or repression of the B-myb promoter in a cell type-dependent manner.
12963728 2003 Identification of new subunits of the multiprotein mammalian TRRAP/TIP60-containing histone acetyltransferase complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12391155 2002 Role for the mortality factors MORF4, MRGX, and MRG15 in transcriptional repression via associations with Pf1, mSin3A, and Transducin-Like Enhancer of Split.
11988016 2002 Interaction of a paraneoplastic cerebellar degeneration-associated neuronal protein with the nuclear helix-loop-helix leucine zipper protein MRG X.
10942595 2000 A visual intracellular classification strategy for uncharacterized human proteins.
9891081 1999 Identification of a gene that reverses the immortal phenotype of a subset of cells and is a member of a novel family of transcription factor-like genes.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7584028 1994 Prediction of the coding sequences of unidentified human genes. I. The coding sequences of 40 new genes (KIAA0001-KIAA0040) deduced by analysis of randomly sampled cDNA clones from human immature myeloid cell line KG-1 (supplement).
7584026 1994 Prediction of the coding sequences of unidentified human genes. I. The coding sequences of 40 new genes (KIAA0001-KIAA0040) deduced by analysis of randomly sampled cDNA clones from human immature myeloid cell line KG-1.