Property Summary

NCBI Gene PubMed Count 36
PubMed Score 38.05
PubTator Score 24.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Adenoid Cystic Carcinoma 99
Disease Target Count Z-score Confidence
substance-related disorder 104 0.0 2.0

Expression

Gene RIF (12)

PMID Text
22728643 Both MRG15 CD and Pf1 PHD1 bind to their targets with >100 muM affinity.
21466675 While the present study expands on the role of MRG15 in the control of genomic stability, weak associations can not be ruled out for potential low-penetrance variants at MORF4L1 and breast cancer risk among BRCA2 mutation carriers
20844547 it seems unlikely that any constitutional changes in MRG15 confer an increased risk for breast cancer.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20332121 gene deficiency reduces DNA repair and increase sensitivity to DNA-crosslinking agents
19553677 MRG15 is a novel PALB2-interacting factor involved in homologous recombination
17573780 RBP2 associates with MRG15 complex to maintain reduced H3K4 methylation at transcribed regions, which may ensure the transcriptional elongation state
17460191 MORF4 has a role in cellular aging, and MRG15 associates with both histone deacetylases and histone acetyl transferase complexes [review]
17135209 The MRG15 chromo domain may function as an adaptor module which can bind to a modified histone H3 in a mode different from that of the HP1/Pc chromo domains.
17008723 identify MRG15 residues that form a shallow hydrophobic pocket to interact with the N-terminal 50 residues of PAM14 through primarily hydrophobic interactions
16407074 Site-directed mutagenesis studies of a prototypic MRG domain from human MRG15 based on the X-ray structure and bioinformatics identify key residues involved in the binding of PAM14 and MRGBP.
12397079 a novel chromodomain protein that is present in two distinct multiprotein complexes involved in transcriptional activation

AA Sequence

MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKKSAVRPRRSEKSLKTHEDI      1 - 70
VALFPVPEGAPSVHHPLLTSSWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGAAPGKKTSGL     71 - 140
QQKNVEVKTKKNKQKTPGNGDGGSTSETPQPPRKKRARVDPTVENEETFMNRVEVKVKIPEELKPWLVDD    141 - 210
WDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQ    211 - 280
YAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDY    281 - 350
EVAPPEYHRKAV                                                              351 - 362
//

Text Mined References (41)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22728643 2012 Sequence requirements for combinatorial recognition of histone H3 by the MRG15 and Pf1 subunits of the Rpd3S/Sin3S corepressor complex.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21466675 2011 Exploring the link between MORF4L1 and risk of breast cancer.
21378988 2011 A genome-wide association study in Europeans and South Asians identifies five new loci for coronary artery disease.
21269460 2011 Initial characterization of the human central proteome.
20844547 2010 Mutation analysis of the gene encoding the PALB2-binding protein MRG15 in BRCA1/2-negative breast cancer families.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20332121 2010 MRG15 binds directly to PALB2 and stimulates homology-directed repair of chromosomal breaks.
19650074 2009 p8/nupr1 regulates DNA-repair activity after double-strand gamma irradiation-induced DNA damage.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19553677 2009 MRG15 is a novel PALB2-interacting factor involved in homologous recombination.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17577209 2007 The interactome of the histone gene regulatory factor HiNF-P suggests novel cell cycle related roles in transcriptional control and RNA processing.
17573780 2007 RBP2 is an MRG15 complex component and down-regulates intragenic histone H3 lysine 4 methylation.
17460191 2007 The role of the MORF/MRG family of genes in cell growth, differentiation, DNA repair, and thereby aging.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17135209 2006 Structure of human MRG15 chromo domain and its binding to Lys36-methylated histone H3.
17008723 2006 The MRG domain of human MRG15 uses a shallow hydrophobic pocket to interact with the N-terminal region of PAM14.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16407074 2006 Multipurpose MRG domain involved in cell senescence and proliferation exhibits structural homology to a DNA-interacting domain.
16230350 2005 A mammalian chromatin remodeling complex with similarities to the yeast INO80 complex.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15647280 2005 The mammalian YL1 protein is a shared subunit of the TRRAP/TIP60 histone acetyltransferase and SRCAP complexes.
15635413 2005 Nucleolar proteome dynamics.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15367658 2004 PAM14, a novel MRG- and Rb-associated protein, is not required for development and T-cell function in mice.
15196461 2004 The highly conserved and multifunctional NuA4 HAT complex.
14966270 2004 Structural and functional conservation of the NuA4 histone acetyltransferase complex from yeast to humans.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14506250 2003 MRGX is a novel transcriptional regulator that exhibits activation or repression of the B-myb promoter in a cell type-dependent manner.
12963728 2003 Identification of new subunits of the multiprotein mammalian TRRAP/TIP60-containing histone acetyltransferase complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12397079 2002 MRG15, a novel chromodomain protein, is present in two distinct multiprotein complexes involved in transcriptional activation.
12391155 2002 Role for the mortality factors MORF4, MRGX, and MRG15 in transcriptional repression via associations with Pf1, mSin3A, and Transducin-Like Enhancer of Split.
11500496 2001 MRG15 activates the B-myb promoter through formation of a nuclear complex with the retinoblastoma protein and the novel protein PAM14.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
9891081 1999 Identification of a gene that reverses the immortal phenotype of a subset of cells and is a member of a novel family of transcription factor-like genes.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.