Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.82
PubTator Score 3.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
active Crohn's disease 1.208 3.3e-03
acute quadriplegic myopathy 1.092 3.0e-05
aldosterone-producing adenoma -1.047 3.4e-02
Astrocytoma, Pilocytic 1.200 7.3e-05
atypical teratoid / rhabdoid tumor 1.500 4.6e-07
colon cancer 1.400 1.5e-02
diabetes mellitus -1.100 4.8e-03
ependymoma 1.500 4.2e-08
glioblastoma 1.300 4.8e-05
group 3 medulloblastoma 1.400 6.9e-04
ovarian cancer -1.700 4.1e-08
pediatric high grade glioma 1.400 2.3e-04
psoriasis -1.200 1.6e-03
ulcerative colitis 1.200 1.6e-05

Gene RIF (5)

AA Sequence

MLLYRGAPAGPGAPGCGLARPGGGPQAFGIRLSTMSPRYLQSNSSSHTRPFSAIAELLDNAVDPDVSART      1 - 70
VFIDVEEVKNKSCLTFTDDGCGMTPHKLHRMLSFGFTDKVIKKSQCPIGVFGNGFKSGSMRLGKDALVFT     71 - 140
KNGGTLTVGLLSQTYLECVQAQAVIVPIVPFNQQNKKMIITEDSLPSLEAILNYSIFNRENDLLAQFDAI    141 - 210
PGKKGTRVLIWNIRRNKNGKSELDFDTDQYDILVSDFDTEEKMTGGVTSELPETEYSLRAFCGILYMKPR    211 - 280
MKIFLRQKKVTTQMIAKSLANVEYDTYKPTFTNKQVRITFGFSCKNSNQFGIMMYHNNRLIKSFEKVGCQ    281 - 350
VKPTRGEGVGVIGVIECNFLKPAYNKQDFEYTKEYRLTINALAQKLNAYWKEKTSQDNFETSTVARPIPK    351 - 420
VPDQTWVQCDECLKWRKLPGKIDPSMLPARWFCYYNSHPKYRRCSVPEEQELTDEDLCLSKAKKQEQTVE    421 - 490
EKKKMPMENENHQVFSNPPKILTVQEMAGLNNKTIGYEGIHSPSVLPSGGEESRSPSLQLKPLDSSVLQF    491 - 560
SSKYKWILGEEPVEKRRRLQNEMTTPSLDYSMPAPYRRVEAPVAYPEGENSHDKSSSERSTPPYLFPEYP    561 - 630
EASKNTGQNREVSILYPGAKDQRQGSLLPEELEDQMPRLVAEESNRGSTTINKEEVNKGPFVAVVGVAKG    631 - 700
VRDSGAPIQLIPFNREELAERRKAVESWNPVPYSVASAAIPAAAIGEKARGYEESEGHNTPKLKNQRELE    701 - 770
ELKRTTEKLERVLAERNLFQQKVEELEQERNHWQSEFKKVQHELVIYSTQEAEGLYWSKKHMGYRQAEFQ    771 - 840
ILKAELERTKEEKQELKEKLKETETHLEMLQKAQVSYRTPEGDDLERALAKLTRLRIHVSYLLTSVLPHL    841 - 910
ELREIGYDSEQVDGILYTVLEANHILD                                               911 - 937
//

Text Mined References (14)

PMID Year Title