Property Summary

NCBI Gene PubMed Count 19
PubMed Score 28.99
PubTator Score 22.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.219 7.8e-03
Multiple myeloma 1.045 1.3e-02
acute myeloid leukemia 2.100 4.8e-02

Gene RIF (10)

PMID Text
26202233 Downregulation of NXP2/MORC3 by use of two independent short hairpin RNAs reduced virus titers in low-multiplicity infections. Analysis of viral RNA in high-multiplicity infections showed a reduction of viral RNA and mRNA after NXP2/MORC3 downregulation.
26028648 Case Report: manifestations of interstitial lung disease in adult dermatomyositis patient with anti-NPX2 autoantibodies.
24217940 Case Report: Pemphigus foliaceus associated with anti-NXP2 autoantibody-positive amyopathic dermatomyositis.
24037894 These studies demonstrate that anti-NXP-2 and anti-TIF-1gamma antibodies are frequent DM specificities (found in 55% of patients) and are present in most patients with cancer-associated dermatomhyositis.
22546500 An anti-MJ antibody that recognizes NXP-2 was found to be a useful biomarker in dermatomyositis-polymyositis patients.
22258483 Anti-NXP2 Ab may be associated with adult idiopathic inflammatory myopathies with malignancy.
20501696 MORC3 colocalizes with PML by a two-step molecular mechanism.
17332504 MORC3 (microrchidia3)-ATPase activated p53 and induced cellular senescence in normal fibroblasts but not p53-/- fibroblasts
16567619 When tethered to a promoter by fusion to Gal4, NXP-2 repressed transcription, consistent with a role for NXP-2 in SUMO-mediated repression
11927593 determination of nuclear matrix-binding, RNA-binding, and coiled-coil domans

AA Sequence

MAAQPPRGIRLSALCPKFLHTNSTSHTWPFSAVAELIDNAYDPDVNAKQIWIDKTVINDHICLTFTDNGN      1 - 70
GMTSDKLHKMLSFGFSDKVTMNGHVPVGLYGNGFKSGSMRLGKDAIVFTKNGESMSVGLLSQTYLEVIKA     71 - 140
EHVVVPIVAFNKHRQMINLAESKASLAAILEHSLFSTEQKLLAELDAIIGKKGTRIIIWNLRSYKNATEF    141 - 210
DFEKDKYDIRIPEDLDEITGKKGYKKQERMDQIAPESDYSLRAYCSILYLKPRMQIILRGQKVKTQLVSK    211 - 280
SLAYIERDVYRPKFLSKTVRITFGFNCRNKDHYGIMMYHRNRLIKAYEKVGCQLRANNMGVGVVGIIECN    281 - 350
FLKPTHNKQDFDYTNEYRLTITALGEKLNDYWNEMKVKKNTEYPLNLPVEDIQKRPDQTWVQCDACLKWR    351 - 420
KLPDGMDQLPEKWYCSNNPDPQFRNCEVPEEPEDEDLVHPTYEKTYKKTNKEKFRIRQPEMIPRINAELL    421 - 490
FRPTALSTPSFSSPKESVPRRHLSEGTNSYATRLLNNHQVPPQSEPESNSLKRRLSTRSSILNAKNRRLS    491 - 560
SQFENSVYKGDDDDEDVIILEENSTPKPAVDHDIDMKSEQSHVEQGGVQVEFVGDSEPCGQTGSTSTSSS    561 - 630
RCDQGNTAATQTEVPSLVVKKEETVEDEIDVRNDAVILPSCVEAEAKIHETQETTDKSADDAGCQLQELR    631 - 700
NQLLLVTEEKENYKRQCHMFTDQIKVLQQRILEMNDKYVKKETCHQSTETDAVFLLESINGKSESPDHMV    701 - 770
SQYQQALEEIERLKKQCSALQHVKAECSQCSNNESKSEMDEMAVQLDDVFRQLDKCSIERDQYKSEVELL    771 - 840
EMEKSQIRSQCEELKTEVEQLKSTNQQTATDVSTSSNIEESVNHMDGESLKLRSLRVNVGQLLAMIVPDL    841 - 910
DLQQVNYDVDVVDEILGQVVEQMSEISST                                             911 - 939
//

Text Mined References (27)

PMID Year Title
26202233 2015 The Cellular Factor NXP2/MORC3 Is a Positive Regulator of Influenza Virus Multiplication.
26028648 2015 Interstitial lung disease in an adult patient with dermatomyositis and anti-NXP2 autoantibody.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24217940 2014 Pemphigus foliaceus associated with anti-NXP2 autoantibody-positive dermatomyositis.
24037894 2013 Most patients with cancer-associated dermatomyositis have antibodies to nuclear matrix protein NXP-2 or transcription intermediary factor 1?.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22546500 2012 Anti-MJ/NXP-2 autoantibody specificity in a cohort of adult Italian patients with polymyositis/dermatomyositis.
22258483 2012 Anti-NXP2 autoantibodies in adult patients with idiopathic inflammatory myopathies: possible association with malignancy.
21269460 2011 Initial characterization of the human central proteome.
20501696 2010 Two-step colocalization of MORC3 with PML nuclear bodies.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17332504 2007 Dynamic regulation of p53 subnuclear localization and senescence by MORC3.
16567619 2006 NXP-2 association with SUMO-2 depends on lysines required for transcriptional repression.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14607086 2003 The CW domain, a structural module shared amongst vertebrates, vertebrate-infecting parasites and higher plants.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11927593 2002 The newly identified human nuclear protein NXP-2 possesses three distinct domains, the nuclear matrix-binding, RNA-binding, and coiled-coil domains.
10830953 2000 The DNA sequence of human chromosome 21.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8590280 1995 Prediction of the coding sequences of unidentified human genes. IV. The coding sequences of 40 new genes (KIAA0121-KIAA0160) deduced by analysis of cDNA clones from human cell line KG-1.