Property Summary

NCBI Gene PubMed Count 22
PubMed Score 55.96
PubTator Score 67.18

Knowledge Summary

Patent (6,235)

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -5.500 3.5e-10
posterior fossa group B ependymoma 1.800 3.3e-10
cystic fibrosis 1.367 1.1e-04
group 3 medulloblastoma 1.500 1.0e-04
nasopharyngeal carcinoma -1.100 1.9e-07
chronic rhinosinusitis -1.162 9.8e-03

Gene RIF (11)

PMID Text
25755699 our results suggest MOK promoter hypomethylation is a common event and contributes to MOK overexpression in acute myeloid leukemia
24529564 The findings indicate a statistically significant association of p.Gly82Ser polymorphism in RAGE with DR in T2DM patients.
24244486 the expressions of ICK/MAK/MOK proteins in the intestinal tract can be differentially and dynamically regulated, implicating a significant functional diversity within this group of protein kinases.
21717246 Our results suggest that RAGE may be important in tumor invasion and could be a potential predictor for the prognosis of hepatocellular carcinoma patients.
21377387 PBMNC from type 2 diabetics were more sensitive to innate immune stimulation with LPS and monoclonal agonist anti-TLR4 than were cells from ND. The actions of LPS, anti-TLR4 and anti-RAGE potentiated the production of IL-6 and TNF-alpha in both groups.
21264954 The RAGE pathway may play an important role in STAT3 induction in glioma-associated macrophages and microglia, a process that may be mediated through S100B.
19060005 POLL is under genetic selection in Sub-Saharan African populations.
18685487 Compared RAGE and PAX-2 staining in metastatic clear renal cell carcinoma.
15900605 May provide suitable targets for immunotherapy of renal cell carcinoma.
15327990 identification of MOK, a member of the mitogen-activated protein kinase superfamily, as one of the genes induced by a caudal-related homeobox transcription factor, Cdx2
12777992 RAGE was demonstrated in all 8 yolk sac tumors and 21 of 26 embryonal carcinomas. In yolk sac tumors, RAGE reactivity was diffusely present throughout the tumors. In embryonal carcinomas, RAGE was identified only in yolk sac components

AA Sequence

MKNYKAIGKIGEGTFSEVMKMQSLRDGNYYACKQMKQRFESIEQVNNLREIQALRRLNPHPNILMLHEVV      1 - 70
FDRKSGSLALICELMDMNIYELIRGRRYPLSEKKIMHYMYQLCKSLDHIHRNGIFHRDVKPENILIKQDV     71 - 140
LKLGDFGSCRSVYSKQPYTEYISTRWYRAPECLLTDGFYTYKMDLWSAGCVFYEIASLQPLFPGVNELDQ    141 - 210
ISKIHDVIGTPAQKILTKFKQSRAMNFDFPFKKGSGIPLLTTNLSPQCLSLLHAMVAYDPDERIAAHQAL    211 - 280
QHPYFQEQRKTEKRALGSHRKAGFPEHPVAPEPLSNSCQISKEGRKQKQSLKQEEDRPKRRGPAYVMELP    281 - 350
KLKLSGVVRLSSYSSPTLQSVLGSGTNGRVPVLRPLKCIPASKKTDPQKDLKPAPQQCRLPTIVRKGGR     351 - 419
//

Text Mined References (24)

PMID Year Title
25755699 2015 MOK overexpression is associated with promoter hypomethylation in patients with acute myeloid leukemia.
24529564 2014 Association of RAGE (p.Gly82Ser) and MnSOD (p.Val16Ala) polymorphisms with diabetic retinopathy in T2DM patients from north India.
24244486 2013 Distinct expression patterns of ICK/MAK/MOK protein kinases in the intestine implicate functional diversity.
21717246 2012 Overexpression of renal tumor antigen is associated with tumor invasion and poor prognosis of hepatocellular carcinoma.
21377387 2011 TLR4 and RAGE: similar routes leading to inflammation in type 2 diabetic patients.
21264954 2011 S100B attenuates microglia activation in gliomas: possible role of STAT3 pathway.
19060005 2009 Targeted resequencing of two genes, RAGE and POLL, confirms findings from a genome-wide scan for adaptive evolution and provides evidence for positive selection in additional populations.
18685487 2008 The utility of PAX-2 in distinguishing metastatic clear cell renal cell carcinoma from its morphologic mimics: an immunohistochemical study with comparison to renal cell carcinoma marker.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17549666 Usefulness of CDK5RAP3, CCNB2, and RAGE genes for the diagnosis of lung adenocarcinoma.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15900605 2005 Generation of RAGE-1 and MAGE-9 peptide-specific cytotoxic T-lymphocyte lines for transfer in patients with renal cell carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15327990 2004 Cdx2 homeodomain protein regulates the expression of MOK, a member of the mitogen-activated protein kinase superfamily, in the intestinal epithelial cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12777992 2003 Renal cell carcinoma antigen is expressed by yolk sac tumors and yolk sac elements of embryonal carcinomas.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12206267 2002 Tumor-associated antigens as possible targets for immune therapy in head and neck cancer: comparative mRNA expression analysis of RAGE and GAGE genes.
12190937 2002 mRNA expression of tumor-associated antigens in melanoma tissues and cell lines.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
10421840 1999 Molecular cloning and characterization of a novel member of the MAP kinase superfamily.
8781117 1996 A new gene coding for an antigen recognized by autologous cytolytic T lymphocytes on a human renal carcinoma.