Property Summary

NCBI Gene PubMed Count 15
PubMed Score 176.09
PubTator Score 78.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.459 1.1e-04
ovarian cancer 1.200 1.2e-04

Protein-protein Interaction (7)

Gene RIF (33)

PMID Text
24716661 A shortened immunoglobulin half-life was determined to be the mechanism underlying the hypogammaglobulinemia in congenital disorder of glycosylation type IIb (CDG-IIb).
23125841 Tandem affinity purification and mass spectrometry analysis identify mannosyl-oligosaccharide glucosidase (MOGS; GCS1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22190034 Tandem affinity purification and mass spectrometry analysis identify mannosyl-oligosaccharide glucosidase (MOGS; GCS1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
16547752 Tandem affinity purification and mass spectrometry analysis identify mannosyl-oligosaccharide glucosidase (MOGS; GCS1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
12719582 Tandem affinity purification and mass spectrometry analysis identify mannosyl-oligosaccharide glucosidase (MOGS; GCS1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
12626409 identification of sequence motifs responsible for endoplasmic reticulum localization
12560567 Tandem affinity purification and mass spectrometry analysis identify mannosyl-oligosaccharide glucosidase (MOGS; GCS1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
12490281 MafF/NFE2 hetrodimers act as weak transcriptional activators, and, in particular, are able to stimulate activity of the GCS1 promoter.
11942856 Perturbation of free oligosaccharide trafficking in endoplasmic reticulum glucosidase I-deficient and castanospermine-treated cells.
11530211 Tandem affinity purification and mass spectrometry analysis identify mannosyl-oligosaccharide glucosidase (MOGS; GCS1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
9109416 Tandem affinity purification and mass spectrometry analysis identify mannosyl-oligosaccharide glucosidase (MOGS; GCS1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
8794362 Tandem affinity purification and mass spectrometry analysis identify mannosyl-oligosaccharide glucosidase (MOGS; GCS1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
8794361 Tandem affinity purification and mass spectrometry analysis identify mannosyl-oligosaccharide glucosidase (MOGS; GCS1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
8673525 Tandem affinity purification and mass spectrometry analysis identify mannosyl-oligosaccharide glucosidase (MOGS; GCS1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
8416962 Tandem affinity purification and mass spectrometry analysis identify mannosyl-oligosaccharide glucosidase (MOGS; GCS1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
8218172 Tandem affinity purification and mass spectrometry analysis identify mannosyl-oligosaccharide glucosidase (MOGS; GCS1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
8093218 Tandem affinity purification and mass spectrometry analysis identify mannosyl-oligosaccharide glucosidase (MOGS; GCS1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
3264072 Tandem affinity purification and mass spectrometry analysis identify mannosyl-oligosaccharide glucosidase (MOGS; GCS1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
3099781 Tandem affinity purification and mass spectrometry analysis identify mannosyl-oligosaccharide glucosidase (MOGS; GCS1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
2959866 Tandem affinity purification and mass spectrometry analysis identify mannosyl-oligosaccharide glucosidase (MOGS; GCS1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
2829950 Tandem affinity purification and mass spectrometry analysis identify mannosyl-oligosaccharide glucosidase (MOGS; GCS1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
2825177 Tandem affinity purification and mass spectrometry analysis identify mannosyl-oligosaccharide glucosidase (MOGS; GCS1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
2649653 Tandem affinity purification and mass spectrometry analysis identify mannosyl-oligosaccharide glucosidase (MOGS; GCS1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
2542563 Tandem affinity purification and mass spectrometry analysis identify mannosyl-oligosaccharide glucosidase (MOGS; GCS1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
2541446 Tandem affinity purification and mass spectrometry analysis identify mannosyl-oligosaccharide glucosidase (MOGS; GCS1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
2355006 Tandem affinity purification and mass spectrometry analysis identify mannosyl-oligosaccharide glucosidase (MOGS; GCS1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
2283726 Tandem affinity purification and mass spectrometry analysis identify mannosyl-oligosaccharide glucosidase (MOGS; GCS1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
2187500 Tandem affinity purification and mass spectrometry analysis identify mannosyl-oligosaccharide glucosidase (MOGS; GCS1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
2136376 Tandem affinity purification and mass spectrometry analysis identify mannosyl-oligosaccharide glucosidase (MOGS; GCS1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
2076345 Tandem affinity purification and mass spectrometry analysis identify mannosyl-oligosaccharide glucosidase (MOGS; GCS1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
1736542 Tandem affinity purification and mass spectrometry analysis identify mannosyl-oligosaccharide glucosidase (MOGS; GCS1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
1704656 Tandem affinity purification and mass spectrometry analysis identify mannosyl-oligosaccharide glucosidase (MOGS; GCS1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
1678778 Tandem affinity purification and mass spectrometry analysis identify mannosyl-oligosaccharide glucosidase (MOGS; GCS1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells

AA Sequence

MARGERRRRAVPAEGVRTAERAARGGPGRRDGRGGGPRSTAGGVALAVVVLSLALGMSGRWVLAWYRARR      1 - 70
AVTLHSAPPVLPADSSSPAVAPDLFWGTYRPHVYFGMKTRSPKPLLTGLMWAQQGTTPGTPKLRHTCEQG     71 - 140
DGVGPYGWEFHDGLSFGRQHIQDGALRLTTEFVKRPGGQHGGDWSWRVTVEPQDSGTSALPLVSLFFYVV    141 - 210
TDGKEVLLPEVGAKGQLKFISGHTSELGDFRFTLLPPTSPGDTAPKYGSYNVFWTSNPGLPLLTEMVKSR    211 - 280
LNSWFQHRPPGAPPERYLGLPGSLKWEDRGPSGQGQGQFLIQQVTLKIPISIEFVFESGSAQAGGNQALP    281 - 350
RLAGSLLTQALESHAEGFRERFEKTFQLKEKGLSSGEQVLGQAALSGLLGGIGYFYGQGLVLPDIGVEGS    351 - 420
EQKVDPALFPPVPLFTAVPSRSFFPRGFLWDEGFHQLVVQRWDPSLTREALGHWLGLLNADGWIGREQIL    421 - 490
GDEARARVPPEFLVQRAVHANPPTLLLPVAHMLEVGDPDDLAFLRKALPRLHAWFSWLHQSQAGPLPLSY    491 - 560
RWRGRDPALPTLLNPKTLPSGLDDYPRASHPSVTERHLDLRCWVALGARVLTRLAEHLGEAEVAAELGPL    561 - 630
AASLEAAESLDELHWAPELGVFADFGNHTKAVQLKPRPPQGLVRVVGRPQPQLQYVDALGYVSLFPLLLR    631 - 700
LLDPTSSRLGPLLDILADSRHLWSPFGLRSLAASSSFYGQRNSEHDPPYWRGAVWLNVNYLALGALHHYG    701 - 770
HLEGPHQARAAKLHGELRANVVGNVWRQYQATGFLWEQYSDRDGRGMGCRPFHGWTSLVLLAMAEDY       771 - 837
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24716661 2014 Glycosylation, hypogammaglobulinemia, and resistance to viral infections.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18303019 2008 Getting in and out from calnexin/calreticulin cycles.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12626409 2003 (Arg)3 within the N-terminal domain of glucosidase I contains ER targeting information but is not required absolutely for ER localization.
12490281 Cloning MafF by recognition site screening with the NFE2 tandem repeat of HS2: analysis of its role in globin and GCSl genes regulation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12145188 2002 Processing of N-linked carbohydrate chains in a patient with glucosidase I deficiency (CDG type IIb).
10788335 2000 A novel disorder caused by defective biosynthesis of N-linked oligosaccharides due to glucosidase I deficiency.
8786151 1996 Localization of the human glucosidase I gene to chromosome 2p12-p13 by fluorescence in situ hybridization and PCR analysis of somatic cell hybrids.
7635146 1995 Cloning and expression of glucosidase I from human hippocampus.