Property Summary

NCBI Gene PubMed Count 18
PubMed Score 2.06
PubTator Score 1.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
atypical teratoid/rhabdoid tumor -1.400 6.4e-03
Breast cancer -2.400 1.7e-17
breast carcinoma -1.600 9.9e-06
chronic lymphosyte leukemia -1.600 4.6e-11
cystic fibrosis -1.742 2.5e-05
ductal carcinoma in situ -1.400 6.8e-04
group 3 medulloblastoma -2.500 7.6e-05
invasive ductal carcinoma -1.035 8.3e-03
lung adenocarcinoma -1.600 1.2e-17
lung cancer -2.000 1.4e-03
lung carcinoma -1.600 1.0e-23
malignant mesothelioma -1.200 1.4e-05
medulloblastoma, large-cell -1.800 1.5e-02
non-small cell lung cancer -1.473 3.0e-14
osteosarcoma 1.044 1.3e-02
pediatric high grade glioma -1.100 9.9e-03
pituitary cancer -1.100 2.2e-04
subependymal giant cell astrocytoma -1.842 2.3e-02
urothelial carcinoma -1.300 3.4e-02

 GO Function (1)

 Compartment GO Term (0)

Gene RIF (6)

AA Sequence

MSIALKQVFNKDKTFRPKRKFEPGTQRFELHKRAQASLNSGVDLKAAVQLPSGEDQNDWVAVHVVDFFNR      1 - 70
INLIYGTICEFCTERTCPVMSGGPKYEYRWQDDLKYKKPTALPAPQYMNLLMDWIEVQINNEEIFPTCVG     71 - 140
VPFPKNFLQICKKILCRLFRVFVHVYIHHFDRVIVMGAEAHVNTCYKHFYYFVTEMNLIDRKELEPLKEM    141 - 210
TSRMCH                                                                    211 - 216
//

Text Mined References (20)

PMID Year Title