Property Summary

NCBI Gene PubMed Count 18
PubMed Score 2.06
PubTator Score 1.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
urothelial carcinoma -1.300 3.4e-02
malignant mesothelioma -1.200 1.4e-05
osteosarcoma 1.044 1.3e-02
chronic lymphosyte leukemia -1.600 4.6e-11
group 3 medulloblastoma -2.600 4.5e-05
cystic fibrosis -1.742 2.5e-05
medulloblastoma, large-cell -1.800 1.5e-02
non-small cell lung cancer -1.473 3.0e-14
lung cancer -2.000 1.4e-03
breast carcinoma -1.600 9.9e-06
pediatric high grade glioma -1.100 9.9e-03
atypical teratoid/rhabdoid tumor -1.400 6.4e-03
subependymal giant cell astrocytoma -2.627 5.0e-03
lung adenocarcinoma -1.600 1.2e-17
invasive ductal carcinoma -2.800 5.4e-04
Breast cancer -3.100 6.5e-27
lung carcinoma -1.600 1.0e-23
ductal carcinoma in situ -1.500 5.3e-04
pituitary cancer -1.100 2.2e-04

Synonym

Accession Q86TA1 Q8NEB4 Q9H8V4
Symbols MOB1D
C9orf35
MOBKL2B

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

 Compartment GO Term (0)

Gene RIF (6)

PMID Text
26130958 low levels of hMOB3B are closely associated with aggressive clinicopathologic features in patients with prostate cancer. The results suggest that hMOB3B may act as a tumor suppressor in human prostate cancer.
20423481 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MSIALKQVFNKDKTFRPKRKFEPGTQRFELHKRAQASLNSGVDLKAAVQLPSGEDQNDWVAVHVVDFFNR      1 - 70
INLIYGTICEFCTERTCPVMSGGPKYEYRWQDDLKYKKPTALPAPQYMNLLMDWIEVQINNEEIFPTCVG     71 - 140
VPFPKNFLQICKKILCRLFRVFVHVYIHHFDRVIVMGAEAHVNTCYKHFYYFVTEMNLIDRKELEPLKEM    141 - 210
TSRMCH                                                                    211 - 216
//

Text Mined References (20)

PMID Year Title
26130958 2015 Lower Levels of Human MOB3B Are Associated with Prostate Cancer Susceptibility and Aggressive Clinicopathological Characteristics.
23376709 2013 A 2-stage genome-wide association study to identify single nucleotide polymorphisms associated with development of urinary symptoms after radiotherapy for prostate cancer.
21269460 2011 Initial characterization of the human central proteome.
20423481 2010 Lack of replication of genetic predictors for the rheumatoid arthritis response to anti-TNF treatments: a prospective case-only study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19060904 2009 An empirical framework for binary interactome mapping.
18615156 Genome-wide association scan identifies candidate polymorphisms associated with differential response to anti-TNF treatment in rheumatoid arthritis.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.