Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.21
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 733 0.0 0.0
Disease Target Count P-value
ovarian cancer 8297 2.1e-05
osteosarcoma 7766 1.6e-04
ependymoma 4559 6.3e-03
spina bifida 1053 5.0e-02
Disease Target Count Z-score Confidence
Mantle cell lymphoma 18 3.008 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 1.100 6.3e-03
osteosarcoma -2.702 1.6e-04
ovarian cancer 1.300 2.1e-05
spina bifida 1.010 5.0e-02

Synonym

Accession Q96BX8 B3KTF1 O75249 Q8TF69
Symbols MOB1C
moblak
MOB-LAK
MOBKL2A

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MSNPFLKQVFNKDKTFRPKRKFEPGTQRFELHKKAQASLNAGLDLRLAVQLPPGEDLNDWVAVHVVDFFN      1 - 70
RVNLIYGTISDGCTEQSCPVMSGGPKYEYRWQDEHKFRKPTALSAPRYMDLLMDWIEAQINNEDLFPTNV     71 - 140
GTPFPKNFLQTVRKILSRLFRVFVHVYIHHFDRIAQMGSEAHVNTCYKHFYYFVKEFGLIDTKELEPLKE    141 - 210
MTARMCH                                                                   211 - 217
//

Text Mined References (11)

PMID Year Title