Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.89
PubTator Score 2.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Rheumatoid Arthritis 1.300 1.7e-02
osteosarcoma -1.969 5.8e-05
posterior fossa group B ependymoma 1.500 9.8e-07
medulloblastoma, large-cell -1.400 1.7e-03
Amyotrophic Lateral Sclerosis 1.231 3.2e-06
Breast cancer 3.100 2.2e-02
ovarian cancer 1.300 3.8e-02

Protein-protein Interaction (8)

Gene RIF (2)

PMID Text
22454515 Mob1A and Mob1B are needed for cell abscission and centriole re-joining after telophase and cytokinesis.
20970119 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINM      1 - 70
LYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPF     71 - 140
PKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEK    141 - 210
LTSKDR                                                                    211 - 216
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
22863277 2012 Regulation of the Hippo-YAP pathway by G-protein-coupled receptor signaling.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22454515 2012 Human Mob1 proteins are required for cytokinesis by controlling microtubule stability.
20970119 2011 Convergent animal and human evidence suggests a role of PPM1A gene in response to antidepressants.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19739119 2010 Molecular characterization of human homologs of yeast MOB1.
18328708 2008 MOBKL1A/MOBKL1B phosphorylation by MST1 and MST2 inhibits cell proliferation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15197186 2004 Mechanism of activation of NDR (nuclear Dbf2-related) protein kinase by the hMOB1 protein.
15067004 2004 Human Mob proteins regulate the NDR1 and NDR2 serine-threonine kinases.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.