Property Summary

NCBI Gene PubMed Count 32
PubMed Score 23.45
PubTator Score 29.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
astrocytoma 1.100 3.9e-02
breast carcinoma 1.100 6.6e-23
cutaneous lupus erythematosus 1.700 1.1e-03
ependymoma 1.100 6.6e-03
glioblastoma 2.400 7.4e-05
intraductal papillary-mucinous adenoma (... 1.100 1.0e-02
intraductal papillary-mucinous neoplasm ... 1.300 3.7e-02
invasive ductal carcinoma 1.300 1.6e-03
lung adenocarcinoma 2.200 5.2e-03
lung carcinoma -1.300 4.0e-23
medulloblastoma 1.100 1.4e-04
medulloblastoma, large-cell 1.100 1.2e-02
Multiple myeloma 1.003 2.0e-02
osteosarcoma 1.021 3.0e-02
ovarian cancer 1.800 1.3e-03
pancreatic cancer 1.100 7.3e-03
pediatric high grade glioma 1.200 9.3e-05
primary Sjogren syndrome 1.100 8.0e-03
primitive neuroectodermal tumor 1.300 2.3e-03
psoriasis 2.100 1.3e-04
Rheumatoid arthritis 3.000 7.5e-03

Protein-protein Interaction (2)

Gene RIF (8)

AA Sequence

MSFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINM      1 - 70
LYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPF     71 - 140
PKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEK    141 - 210
LGSKDR                                                                    211 - 216
//

Text Mined References (34)

PMID Year Title