Property Summary

NCBI Gene PubMed Count 25
PubMed Score 13.46
PubTator Score 90.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.303 8.1e-03
malignant mesothelioma -1.200 1.2e-06
astrocytic glioma -1.500 5.0e-03
posterior fossa group B ependymoma -1.900 8.2e-13
glioblastoma -2.300 8.4e-07
oligodendroglioma -1.400 7.7e-17
atypical teratoid / rhabdoid tumor -2.400 3.4e-10
medulloblastoma -1.300 3.6e-06
medulloblastoma, large-cell -1.900 7.6e-06
primitive neuroectodermal tumor -1.200 3.2e-04
pediatric high grade glioma -1.900 1.0e-07
pilocytic astrocytoma -1.400 1.7e-07
subependymal giant cell astrocytoma -1.194 4.2e-02
dermatomyositis 1.300 6.9e-04

Synonym

Accession Q96BY2 B2RDF6 Q9H833 Q9HAS1 MAP-1
Symbols MAP-1
PNMA4

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (11)

PMID Text
27003254 PNMA2 functions as antagonist of MOAP-1 and PNMA1 through heterodimeric interaction
26269600 MOAP-1 is a tumor suppressor protein linked to the RASSF1A protein
25998847 miR-25 promotes cell proliferation and inhibits apoptosis in non-small cell lung cancer cells by negatively regulating MOAP1 expression.
25251443 Paraneoplastic Ma antigen-like 1 is suggested as a novel potential clinically useful prognostic biomarker for patients with pancreatic ductal adenocarcinoma.
23236846 PB1-F2 protein of influenza A virus interacts with human MOAP-1 protein.
22434376 Enforced miR-1228 expression can reduce MOAP1 expression and delay the progression of stress-induced cell apoptosis.
19100260 Data suggest that TRIM39 can promote apoptosis signalling through stabilization of MOAP-1.
18474619 The association of RASSF1A and MOAP-1 with death receptors involves an ordered recruitment to receptor complexes to promote cell death and inhibit tumor formation.
17535899 Inhibition of ubiquitin-mediated degradation of MOAP1 by apoptotic stimuli promotes BAX function in mitochondria.
16344548 RASSF1A is a tumor suppressor that activates Bax via MOAP-1
15949439 RASSF1A and MAP-1 are important components between death receptors and the apoptotic machenery.

AA Sequence

MTLRLLEDWCRGMDMNPRKALLIAGISQSCSVAEIEEALQAGLAPLGEYRLLGRMFRRDENRKVALVGLT      1 - 70
AETSHALVPKEIPGKGGIWRVIFKPPDPDNTFLSRLNEFLAGEGMTVGELSRALGHENGSLDPEQGMIPE     71 - 140
MWAPMLAQALEALQPALQCLKYKKLRVFSGRESPEPGEEEFGRWMFHTTQMIKAWQVPDVEKRRRLLESL    141 - 210
RGPALDVIRVLKINNPLITVDECLQALEEVFGVTDNPRELQVKYLTTYQKDEEKLSAYVLRLEPLLQKLV    211 - 280
QRGAIERDAVNQARLDQVIAGAVHKTIRRELNLPEDGPAPGFLQLLVLIKDYEAAEEEEALLQAILEGNF    281 - 350
T//

Text Mined References (27)

PMID Year Title
27003254 2016 PNMA2 mediates heterodimeric interactions and antagonizes chemo-sensitizing activities mediated by members of PNMA family.
26269600 2015 Modulator of apoptosis 1 (MOAP-1) is a tumor suppressor protein linked to the RASSF1A protein.
26201719 2015 Identification of novel target genes specifically activated by deregulated E2F in human normal fibroblasts.
25998847 2015 miR-25 targets the modulator of apoptosis 1 gene in lung cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25251443 2015 Paraneoplastic Ma Antigen-Like 1 as a Potential Prognostic Biomarker in Human Pancreatic Ductal Adenocarcinoma.
23472165 2013 Genome-wide association study link novel loci to endometriosis.
23236846 2012 [PB1-F2 protein of influenza A virus interacts with human MOAP-1 protein].
22529100 2012 The Trim39 ubiquitin ligase inhibits APC/CCdh1-mediated degradation of the Bax activator MOAP-1.
22434376 2012 miR-1228 prevents cellular apoptosis through targeting of MOAP1 protein.
19366867 2009 Paraneoplastic antigen-like 5 gene (PNMA5) is preferentially expressed in the association areas in a primate specific manner.
19100260 2009 TRIM39 is a MOAP-1-binding protein that stabilizes MOAP-1 through inhibition of its poly-ubiquitination process.
18474619 2008 Dynamics of RASSF1A/MOAP-1 association with death receptors.
17535899 2007 Inhibition of ubiquitin-mediated degradation of MOAP-1 by apoptotic stimuli promotes Bax function in mitochondria.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16381901 2006 The LIFEdb database in 2006.
16344548 2006 The RASSF1A tumor suppressor activates Bax via MOAP-1.
16199525 2005 MAP-1 is a mitochondrial effector of Bax.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15949439 2005 The tumor suppressor RASSF1A and MAP-1 link death receptor signaling to Bax conformational change and cell death.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11060313 2001 MAP-1, a novel proapoptotic protein containing a BH3-like motif that associates with Bax through its Bcl-2 homology domains.