Property Summary

NCBI Gene PubMed Count 23
PubMed Score 35.44
PubTator Score 38.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
cutaneous lupus erythematosus 2.100 2.2e-03
osteosarcoma -3.250 2.8e-03
chronic lymphosyte leukemia -1.300 7.6e-03
glioblastoma 2.900 5.0e-04
medulloblastoma -1.100 3.5e-02
medulloblastoma, large-cell -1.700 6.5e-03
adrenocortical carcinoma -1.560 3.0e-02
tuberculosis 3.100 1.5e-06
non-small cell lung cancer -2.426 6.6e-21
intraductal papillary-mucinous adenoma (... -2.000 1.0e-02
intraductal papillary-mucinous carcinoma... -2.400 5.3e-03
intraductal papillary-mucinous neoplasm ... -2.400 2.7e-02
lung cancer -4.600 5.2e-07
interstitial cystitis 2.800 1.2e-03
pediatric high grade glioma 1.500 7.6e-03
pilocytic astrocytoma 1.800 2.4e-05
posterior fossa group A ependymoma 1.200 3.7e-03
primary Sjogren syndrome 1.900 3.6e-04
aldosterone-producing adenoma -1.324 2.5e-02
invasive ductal carcinoma 1.571 8.4e-05
lung adenocarcinoma -1.639 5.9e-04
psoriasis 1.500 6.6e-07
lung carcinoma -2.700 1.6e-23
gastric carcinoma 2.200 1.3e-02
ulcerative colitis 4.000 2.1e-05
ovarian cancer -6.100 7.6e-19
dermatomyositis 3.100 1.0e-03
head and neck cancer -1.800 3.6e-02

Gene RIF (9)

PMID Text
24925224 these data support the inclusion of MNDA in the diagnostic evaluation of extramedullary B-cell lymphomas, particularly those in which the differential diagnosis is between low-grade follicular lymphoma and marginal zone lymphoma.
24557068 Studied the HIN domain of recombinant myeloid nuclear differentiation antigen (MNDA).
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of myeloid cell nuclear differentiation antigen (MNDA) in peptide-treated PBMCs
20595294 Observational study of gene-disease association. (HuGE Navigator)
20193116 Myeloid antigen expression is a predictor of a poor response to chemotherapy, and an adverse prognostic factor in adult T-lymphoblastic lymphoma, but not in children with T-LBL.
19474799 MNDA expression is a useful tool for the recognition of nodal marginal zone lymphoma
16651415 MNDA has a role regulating programmed cell death in myeloid progenitor cells, and that its down-regulation in myelodysplastic syndromes is related to granulocyte-macrophage progenitor cell sensitivity to TRAIL-induced programmed cell death.
15778972 variation in MNDA expression appeared to change with phenotypic specialization of monocytes in atherosclerosis consistent with its association with inflammation and suspected roles in regulating gene expression or in mediating cell death
12112016 Retroviral mediated expression of the human myeloid nuclear antigen in a null cell line upregulates Dlk1 expression

AA Sequence

MVNEYKKILLLKGFELMDDYHFTSIKSLLAYDLGLTTKMQEEYNRIKITDLMEKKFQGVACLDKLIELAK      1 - 70
DMPSLKNLVNNLRKEKSKVAKKIKTQEKAPVKKINQEEVGLAAPAPTARNKLTSEARGRIPVAQKRKTPN     71 - 140
KEKTEAKRNKVSQEQSKPPGPSGASTSAAVDHPPLPQTSSSTPSNTSFTPNQETQAQRQVDARRNVPQND    141 - 210
PVTVVVLKATAPFKYESPENGKSTMFHATVASKTQYFHVKVFDINLKEKFVRKKVITISDYSECKGVMEI    211 - 280
KEASSVSDFNQNFEVPNRIIEIANKTPKISQLYKQASGTMVYGLFMLQKKSVHKKNTIYEIQDNTGSMDV    281 - 350
VGSGKWHNIKCEKGDKLRLFCLQLRTVDRKLKLVCGSHSFIKVIKAKKNKEGPMNVN                 351 - 407
//

Text Mined References (23)

PMID Year Title
24925224 2014 Myeloid cell nuclear differentiation antigen is expressed in a subset of marginal zone lymphomas and is useful in the differential diagnosis with follicular lymphoma.
24557068 2014 Purification, characterization and docking studies of the HIN domain of human myeloid nuclear differentiation antigen (MNDA).
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20595294 2010 Association of IFI200 gene polymorphisms with susceptibility to systemic lupus erythematosus.
20193116 2010 Significance of myeloid antigen expression in precursor T lymphoblastic lymphoma.
19474799 2009 Identification of MNDA as a new marker for nodal marginal zone lymphoma.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17875758 2007 ATM, CTLA4, MNDA, and HEM1 in high versus low CD38 expressing B-cell chronic lymphocytic leukemia.
16651415 2006 Dysregulated human myeloid nuclear differentiation antigen expression in myelodysplastic syndromes: evidence for a role in apoptosis.
16458891 2006 p205, a potential tumor suppressor, inhibits cell proliferation via multiple pathways of cell cycle regulation.
15778972 2005 Variable expression of human myeloid specific nuclear antigen MNDA in monocyte lineage cells in atherosclerosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12112016 2002 Retroviral mediated expression of the human myeloid nuclear antigen in a null cell line upregulates Dlk1 expression.
9712147 1998 Human hematopoietic cell specific nuclear protein MNDA interacts with the multifunctional transcription factor YY1 and stimulates YY1 DNA binding.
8175894 1994 Interferon alpha selectively affects expression of the human myeloid cell nuclear differentiation antigen in late stage cells in the monocytic but not the granulocytic lineage.
7806273 1995 The closely linked genes encoding the myeloid nuclear differentiation antigen (MNDA) and IFI16 exhibit contrasting haemopoietic expression.
7512843 1994 The human myeloid cell nuclear differentiation antigen gene is one of at least two related interferon-inducible genes located on chromosome 1q that are expressed specifically in hematopoietic cells.
7327575 1981 Absence of linkage between transcobalamin II and ABO.
1644857 1992 Cloning and expression of the human myeloid cell nuclear differentiation antigen: regulation by interferon alpha.
1377701 1992 Characterization of the human myeloid cell nuclear differentiation antigen: relationship to interferon-inducible proteins.