Property Summary

NCBI Gene PubMed Count 7
PubMed Score 24.44
PubTator Score 13.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
osteosarcoma -2.374 1.4e-03
glioblastoma 2.000 2.2e-06
sonic hedgehog group medulloblastoma 3.100 2.7e-07
atypical teratoid / rhabdoid tumor 2.300 4.0e-06
medulloblastoma, large-cell 2.400 3.6e-06
primitive neuroectodermal tumor 2.700 1.0e-05
adrenocortical carcinoma 1.964 5.9e-05
non-small cell lung cancer 1.617 3.4e-19
lung adenocarcinoma 1.400 1.1e-06
pediatric high grade glioma 1.600 4.1e-04
posterior fossa group A ependymoma 1.100 7.1e-03
Endometriosis 1.161 4.9e-02
Breast cancer 2.200 6.5e-08
invasive ductal carcinoma 1.700 2.4e-03

Gene RIF (4)

PMID Text
23675907 Data indicate that the positive expression of studied genes fertilization rate for GAPDHS positive subset was 66%, ACR - 71%, SPATA22 - 68%, MND1 - 70%, pregnancy rates were 8%, 6%, 18% and 36% respectively.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18187620 Knockdown of meiotic nuclear divisions 1 homolog (MND1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
16407260 Data suggest that the human TBPIP/Hop2-Mnd1 complex may ensure proper pairing between homologous chromosomes through its stimulation of strand exchange during meiosis.

AA Sequence

MSKKKGLSAEEKRTRMMEIFSETKDVFQLKDLEKIAPKEKGITAMSVKEVLQSLVDDGMVDCERIGTSNY      1 - 70
YWAFPSKALHARKHKLEVLESQLSEGSQKHASLQKSIEKAKIGRCETEERTRLAKELSSLRDQREQLKAE     71 - 140
VEKYKDCDPQVVEEIRQANKVAKEAANRWTDNIFAIKSWAKRKFGFEENKIDRTFGIPEDFDYID         141 - 205
//

Text Mined References (11)

PMID Year Title
23675907 2013 Expression analysis of MND1/GAJ, SPATA22, GAPDHS and ACR genes in testicular biopsies from non-obstructive azoospermia (NOA) patients.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17639080 2007 Bipartite stimulatory action of the Hop2-Mnd1 complex on the Rad51 recombinase.
16407260 2006 Stimulation of DNA strand exchange by the human TBPIP/Hop2-Mnd1 complex.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11940665 2002 The Mnd1 protein forms a complex with hop2 to promote homologous chromosome pairing and meiotic double-strand break repair.