Property Summary

NCBI Gene PubMed Count 73
PubMed Score 125.71
PubTator Score 21.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung cancer 4473 7.8e-04

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer 1.700 7.8e-04

Gene RIF (28)

PMID Text
23765726 The intrinsically programmed MAT1 expression and fragmentation regulate granulopoiesis.
20522537 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19584075 Observational study of gene-disease association. (HuGE Navigator)
17707548 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17707548 These results suggested that genetic variants in CAK genes, Cdk7, cyclin H, MAT1, might modulate the risk of lung cancer in a gene-gene interaction mode, which consist to the biochemical interaction of corresponding proteins.
17628022 Retinoic-acid-induced RAR-CAK signaling events appear to proceed intrinsically during granulocytic development of normal primitive hematopoietic cells. ALDH-governed RA availability may mediate this process by initiating RAR-CAK signaling.
16935935 In response to ATRA, PML/RARalpha is dissociated from CAK, leading to MAT1 degradation, G1 arrest, and decreased CAK phosphorylation of PML/RARalpha
14569024 As a component of the TFIIH transcription complex, MAT1 inhibits HIV-1 Vpr cell cycle-arresting function
12527756 interaction with MTA1 and role in regulating estrogen receptor transactivation functions
12379213 As a component of the TFIIH transcription complex, MAT1 inhibits HIV-1 Vpr cell cycle-arresting function
12213824 Retinoid-induced G1 arrest and differentiation activation are associated with a switch to enzyme hypophosphorylation of retinoic acid receptor alpha.
12140753 The cyclin H/cdk7/Mat1 kinase activity is regulated by CK2 phosphorylation of cyclin H.
10866664 As a component of the TFIIH transcription complex, MAT1 inhibits HIV-1 Vpr cell cycle-arresting function
10438593 As a component of the TFIIH transcription complex, MAT1 inhibits HIV-1 Vpr cell cycle-arresting function
10082552 As a component of the TFIIH transcription complex, MAT1 inhibits HIV-1 Vpr cell cycle-arresting function
10066804 As a component of the TFIIH transcription complex, MAT1 inhibits HIV-1 Vpr cell cycle-arresting function
9765201 As a component of the TFIIH transcription complex, MAT1 inhibits HIV-1 Vpr cell cycle-arresting function
9651670 As a component of the TFIIH transcription complex, MAT1 inhibits HIV-1 Vpr cell cycle-arresting function
9570510 As a component of the TFIIH transcription complex, MAT1 inhibits HIV-1 Vpr cell cycle-arresting function
9334327 As a component of the TFIIH transcription complex, MAT1 inhibits HIV-1 Vpr cell cycle-arresting function
9311822 As a component of the TFIIH transcription complex, MAT1 inhibits HIV-1 Vpr cell cycle-arresting function
9184228 As a component of the TFIIH transcription complex, MAT1 inhibits HIV-1 Vpr cell cycle-arresting function
9121429 As a component of the TFIIH transcription complex, MAT1 inhibits HIV-1 Vpr cell cycle-arresting function
9054383 As a component of the TFIIH transcription complex, MAT1 inhibits HIV-1 Vpr cell cycle-arresting function
8934526 As a component of the TFIIH transcription complex, MAT1 inhibits HIV-1 Vpr cell cycle-arresting function
8849451 As a component of the TFIIH transcription complex, MAT1 inhibits HIV-1 Vpr cell cycle-arresting function
8628270 As a component of the TFIIH transcription complex, MAT1 inhibits HIV-1 Vpr cell cycle-arresting function

AA Sequence

MDDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGTPLRKSNFRVQLFEDPTVDK      1 - 70
EVEIRKKVLKIYNKREEDFPSLREYNDFLEEVEEIVFNLTNNVDLDNTKKKMEIYQKENKDVIQKNKLKL     71 - 140
TREQEELEEALEVERQENEQRRLFIQKEEQLQQILKRKNKQAFLDELESSDLPVALLLAQHKDRSTQLEM    141 - 210
QLEKPKPVKPVTFSTGIKMGQHISLAPIHKLEEALYEYQPLQIETYGPHVPELEMLGRLGYLNHVRAASP    211 - 280
QDLAGGYTSSLACHRALQDAFSGLFWQPS                                             281 - 309
//

Text Mined References (80)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23765726 2013 The lost intrinsic fragmentation of MAT1 protein during granulopoiesis promotes the growth and metastasis of leukemic myeloblasts.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
21269460 2011 Initial characterization of the human central proteome.
20522537 2010 Variation within DNA repair pathway genes and risk of multiple sclerosis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19584075 2009 Novel susceptibility loci for second primary tumors/recurrence in head and neck cancer patients: large-scale evaluation of genetic variants.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17707548 2007 Polymorphisms of CAK genes and risk for lung cancer: a case-control study in Chinese population.
17628022 2007 Intrinsic retinoic acid receptor alpha-cyclin-dependent kinase-activating kinase signaling involves coordination of the restricted proliferation and granulocytic differentiation of human hematopoietic stem cells.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16935935 2006 Retinoic acid induces leukemia cell G1 arrest and transition into differentiation by inhibiting cyclin-dependent kinase-activating kinase binding and phosphorylation of PML/RARalpha.
16782892 2006 Regulated activating Thr172 phosphorylation of cyclin-dependent kinase 4(CDK4): its relationship with cyclins and CDK "inhibitors".
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15328539 2004 A uniform procedure for the purification of CDK7/CycH/MAT1, CDK8/CycC and CDK9/CycT1.
15282296 2004 BRCA1 can modulate RNA polymerase II carboxy-terminal domain phosphorylation levels.
15220921 2004 A new, tenth subunit of TFIIH is responsible for the DNA repair syndrome trichothiodystrophy group A.
14569024 2003 The Tat/TAR-dependent phosphorylation of RNA polymerase II C-terminal domain stimulates cotranscriptional capping of HIV-1 mRNA.
12646563 2003 Rrn3 becomes inactivated in the process of ribosomal DNA transcription.
12527756 2003 MTA1 interacts with MAT1, a cyclin-dependent kinase-activating kinase complex ring finger factor, and regulates estrogen receptor transactivation functions.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393749 2002 Multiple interactions between RNA polymerase I, TIF-IA and TAF(I) subunits regulate preinitiation complex assembly at the ribosomal gene promoter.
12379213 2002 Transcription factor TFIIH components enhance the GR coactivator activity but not the cell cycle-arresting activity of the human immunodeficiency virus type-1 protein Vpr.
12213824 2002 Retinoid-induced G1 arrest and differentiation activation are associated with a switch to cyclin-dependent kinase-activating kinase hypophosphorylation of retinoic acid receptor alpha.
12140753 2002 The cyclin H/cdk7/Mat1 kinase activity is regulated by CK2 phosphorylation of cyclin H.
11445587 2001 A yeast four-hybrid system identifies Cdk-activating kinase as a regulator of the XPD helicase, a subunit of transcription factor IIH.
11313499 2001 Structural basis of transcription: an RNA polymerase II elongation complex at 3.3 A resolution.
11113200 2001 MAT1-modulated CAK activity regulates cell cycle G(1) exit.
11113176 2001 Studies of nematode TFIIE function reveal a link between Ser-5 phosphorylation of RNA polymerase II and the transition from transcription initiation to elongation.
11056214 2000 The MAT1 cyclin-dependent kinase-activating kinase (CAK) assembly/targeting factor interacts physically with the MCM7 DNA licensing factor.
11056162 2001 Solution structure of the N-terminal domain of the human TFIIH MAT1 subunit: new insights into the RING finger family.
10949034 2000 Activation of estrogen receptor alpha by S118 phosphorylation involves a ligand-dependent interaction with TFIIH and participation of CDK7.
10866664 2000 Tat modifies the activity of CDK9 to phosphorylate serine 5 of the RNA polymerase II carboxyl-terminal domain during human immunodeficiency virus type 1 transcription.
10801852 2000 Distinct regions of MAT1 regulate cdk7 kinase and TFIIH transcription activities.
10583946 1999 Quality control by DNA repair.
10438593 1999 Direct evidence that HIV-1 Tat stimulates RNA polymerase II carboxyl-terminal domain hyperphosphorylation during transcriptional elongation.
10428966 1999 Residues phosphorylated by TFIIH are required for E2F-1 degradation during S-phase.
10214908 DNA damage recognition during nucleotide excision repair in mammalian cells.
10082552 1999 Tat activates human immunodeficiency virus type 1 transcriptional elongation independent of TFIIH kinase.
10066804 1999 Tat-associated kinase (P-TEFb): a component of transcription preinitiation and elongation complexes.
10024882 1999 Reconstitution of the transcription factor TFIIH: assignment of functions for the three enzymatic subunits, XPB, XPD, and cdk7.
9852112 1998 Immunoaffinity purification and functional characterization of human transcription factor IIH and RNA polymerase II from clonal cell lines that conditionally express epitope-tagged subunits of the multiprotein complexes.
9840937 1998 Regulation of CAK kinase activity by p53.
9790902 1998 Cloning and characterization of three human cDNAs encoding mRNA (guanine-7-)-methyltransferase, an mRNA cap methylase.
9765201 1998 The HIV-1 Tat cellular coactivator Tat-SF1 is a general transcription elongation factor.
9651670 1998 Transcriptional control: Tat cofactors and transcriptional elongation.
9582279 1998 Cloning and functional characterization of PTRF, a novel protein which induces dissociation of paused ternary transcription complexes.
9570510 1998 Tat, Tat-associated kinase, and transcription.
9512541 1998 Isolation and characterization of a human cDNA for mRNA 5'-capping enzyme.
9465303 1998 Mapping of the human genes encoding cyclin H (CCNH) and the CDK-activating kinase (CAK) assembly factor MAT1 (MNAT1) to chromosome bands 5q13.3-q14 and 14q23, respectively.
9405375 1997 Three transitions in the RNA polymerase II transcription complex during initiation.
9372954 1997 p53 is phosphorylated by CDK7-cyclin H in a p36MAT1-dependent manner.
9368058 1997 The cyclin-dependent kinase-activating kinase (CAK) assembly factor, MAT1, targets and enhances CAK activity on the POU domains of octamer transcription factors.
9334327 1997 The HIV transactivator TAT binds to the CDK-activating kinase and activates the phosphorylation of the carboxy-terminal domain of RNA polymerase II.
9311822 1997 A human primary T-lymphocyte-derived human immunodeficiency virus type 1 Tat-associated kinase phosphorylates the C-terminal domain of RNA polymerase II and induces CAK activity.
9184228 1997 Purification of a Tat-associated kinase reveals a TFIIH complex that modulates HIV-1 transcription.
9130708 1997 Substrate specificity of the cdk-activating kinase (CAK) is altered upon association with TFIIH.
9121429 1997 The human immunodeficiency virus transactivator Tat interacts with the RNA polymerase II holoenzyme.
9118947 1997 Cloning and characterization of p52, the fifth subunit of the core of the transcription/DNA repair factor TFIIH.
9054383 1997 Association of Tat with purified HIV-1 and HIV-2 transcription preinitiation complexes.
8946909 1996 The general transcription factors of RNA polymerase II.
8934526 1996 Enhanced processivity of RNA polymerase II triggered by Tat-induced phosphorylation of its carboxy-terminal domain.
8849451 1996 Tat-SF1: cofactor for stimulation of transcriptional elongation by HIV-1 Tat.
8692842 1996 Human cyclin-dependent kinase-activating kinase exists in three distinct complexes.
8692841 1996 Isolation and characterization of two human transcription factor IIH (TFIIH)-related complexes: ERCC2/CAK and TFIIH.
8628270 1996 Three functional classes of transcriptional activation domain.
8521818 1995 In vitro assembly of a functional human CDK7-cyclin H complex requires MAT1, a novel 36 kDa RING finger protein.
8521393 1995 Molecular cloning of CDK7-associated human MAT1, a cyclin-dependent kinase-activating kinase (CAK) assembly factor.
8308015 1994 Phosphorylation of the human estrogen receptor. Identification of hormone-regulated sites and examination of their influence on transcriptional activity.
7799941 1995 Effects of phosphorylation by CAK on cyclin binding by CDC2 and CDK2.
7629134 1995 Both p16 and p21 families of cyclin-dependent kinase (CDK) inhibitors block the phosphorylation of cyclin-dependent kinases by the CDK-activating kinase.
2449431 1988 ATP activates transcription initiation from promoters by RNA polymerase II in a reversible step prior to RNA synthesis.
1939271 1991 Abortive initiation is increased only for the weakest members of a set of down mutants of the adenovirus 2 major late promoter.