Property Summary

NCBI Gene PubMed Count 18
PubMed Score 4.50
PubTator Score 10.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
nephrosclerosis 1.369 9.3e-05
osteosarcoma -2.160 8.9e-03
medulloblastoma, large-cell -1.300 2.5e-04
juvenile dermatomyositis 1.224 1.9e-08
non-small cell lung cancer -2.230 1.5e-18
intraductal papillary-mucinous adenoma (... -2.100 9.3e-04
intraductal papillary-mucinous carcinoma... -2.200 8.6e-04
intraductal papillary-mucinous neoplasm ... -2.200 8.8e-03
lung cancer -1.300 1.9e-03
breast carcinoma -1.200 2.6e-04
lung adenocarcinoma -1.400 4.4e-13
ductal carcinoma in situ -1.800 1.9e-04
invasive ductal carcinoma -2.700 2.0e-04
ovarian cancer 1.200 1.3e-02
Breast cancer -1.100 4.9e-07

Gene RIF (2)

PMID Text
25745997 Results suggest that CLEC14A-MMRN2 binding has a role in inducing sprouting angiogenesis during tumor growth, which has the potential to be manipulated in future antiangiogenic therapy design.
23979707 CLEC14A is a matrix component which binds to MMRN2 in the process of endothelial cells transformation in tumor angiogenesis.

AA Sequence

MILSLLFSLGGPLGWGLLGAWAQASSTSLSDLQSSRTPGVWKAEAEDTGKDPVGRNWCPYPMSKLVTLLA      1 - 70
LCKTEKFLIHSQQPCPQGAPDCQKVKVMYRMAHKPVYQVKQKVLTSLAWRCCPGYTGPNCEHHDSMAIPE     71 - 140
PADPGDSHQEPQDGPVSFKPGHLAAVINEVEVQQEQQEHLLGDLQNDVHRVADSLPGLWKALPGNLTAAV    141 - 210
MEANQTGHEFPDRSLEQVLLPHVDTFLQVHFSPIWRSFNQSLHSLTQAIRNLSLDVEANRQAISRVQDSA    211 - 280
VARADFQELGAKFEAKVQENTQRVGQLRQDVEDRLHAQHFTLHRSISELQADVDTKLKRLHKAQEAPGTN    281 - 350
GSLVLATPGAGARPEPDSLQARLGQLQRNLSELHMTTARREEELQYTLEDMRATLTRHVDEIKELYSESD    351 - 420
ETFDQISKVERQVEELQVNHTALRELRVILMEKSLIMEENKEEVERQLLELNLTLQHLQGGHADLIKYVK    421 - 490
DCNCQKLYLDLDVIREGQRDATRALEETQVSLDERRQLDGSSLQALQNAVDAVSLAVDAHKAEGERARAA    491 - 560
TSRLRSQVQALDDEVGALKAAAAEARHEVRQLHSAFAALLEDALRHEAVLAALFGEEVLEEMSEQTPGPL    561 - 630
PLSYEQIRVALQDAASGLQEQALGWDELAARVTALEQASEPPRPAEHLEPSHDAGREEAATTALAGLARE    631 - 700
LQSLSNDVKNVGRCCEAEAGAGAASLNASLHGLHNALFATQRSLEQHQRLFHSLFGNFQGLMEANVSLDL    701 - 770
GKLQTMLSRKGKKQQKDLEAPRKRDKKEAEPLVDIRVTGPVPGALGAALWEAGSPVAFYASFSEGTAALQ    771 - 840
TVKFNTTYINIGSSYFPEHGYFRAPERGVYLFAVSVEFGPGPGTGQLVFGGHHRTPVCTTGQGSGSTATV    841 - 910
FAMAELQKGERVWFELTQGSITKRSLSGTAFGGFLMFKT                                   911 - 949
//

Text Mined References (20)

PMID Year Title
25745997 2015 Blocking CLEC14A-MMRN2 binding inhibits sprouting angiogenesis and tumour growth.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22532453 2012 Identification of ovarian cancer-associated proteins in symptomatic women: A novel method for semi-quantitative plasma proteomics.
22334695 2012 EMILIN-3, peculiar member of elastin microfibril interface-located protein (EMILIN) family, has distinct expression pattern, forms oligomeric assemblies, and serves as transforming growth factor ? (TGF-?) antagonist.
22020326 2012 MULTIMERIN2 impairs tumor angiogenesis and growth by interfering with VEGF-A/VEGFR2 pathway.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18327805 2008 N-glycoprotein profiling of lung adenocarcinoma pleural effusions by shotgun proteomics.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16420310 2006 Expression of stromal cell markers in distinct compartments of human skin cancers.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12221002 2002 Developmental expression and biochemical characterization of Emu family members.
11559704 2001 Molecular cloning and characterization of EndoGlyx-1, an EMILIN-like multisubunit glycoprotein of vascular endothelium.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7933987 1994 Identification of a high molecular weight endothelial cell surface glycoprotein, endoGlyx-1, in normal and tumor blood vessels.