Property Summary

NCBI Gene PubMed Count 2,253
PubMed Score 8199.72
PubTator Score 5939.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
non-small cell lung cancer 2798 2.43756511285626E-14
lung adenocarcinoma 2714 1.42529845739495E-13
glioblastoma multiforme 347 1.23425447372532E-6
malignant mesothelioma 3163 1.51181832990584E-5
tuberculosis 1563 5.81135671741191E-5
primary Sjogren syndrome 789 1.39955287469209E-4
posterior fossa group A ependymoma 1511 1.8333617149062E-4
pancreatic cancer 2300 1.99839322686559E-4
lung cancer 4473 3.88377677355132E-4
primary pancreatic ductal adenocarcinoma 1271 4.04493893772118E-4
invasive ductal carcinoma 2950 4.57216315368804E-4
cutaneous lupus erythematosus 1056 6.85734483816635E-4
psoriasis 6685 9.81133337330294E-4
cystic fibrosis 1670 0.0012862564027391
head and neck cancer and chronic obstructive pulmonary disease 237 0.00334499614588925
interstitial cystitis 2299 0.00659340851705262
mucosa-associated lymphoid tissue lymphoma 480 0.0112655369733149
ductal carcinoma in situ 1745 0.011443995648081
breast carcinoma 1614 0.0151480696136191
esophageal adenocarcinoma 737 0.0190553920760902
colon cancer 1475 0.0224256054362225
atypical teratoid / rhabdoid tumor 4369 0.023736300812448
Breast cancer 3099 0.036785576770086
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.037875145725776
Disease Target Count
Intervertebral disc disease 6

Expression

See source...

Synonym

Accession P14780 B2R7V9 Q3LR70 Q8N725 Q9H4Z1 Q9UCJ9 Q9UCL1 Q9UDK2 MMP-9
Symbols GELB
CLG4B
MMP-9
MANDP2

Gene

PDB

1GKC   1GKD   1ITV   1L6J   1LKG   2OVX   2OVZ   2OW0   2OW1   2OW2   4H1Q   4H2E   4H3X   4H82   4HMA   4JIJ   4JQG   4WZV   4XCT   5CUH   5I12  

  Ortholog (12)

Gene RIF (2330)

PMID Text
27215085 MMP9 and PIWIL2 expression levels in cancerous tissues were significantly higher than the adjacent normal tissues
27089280 Low MMP9 expression is associated with Sepsis.
27078876 Data show that spider venom sphingomyelinase D increased expression/secretion of MMP2, MMP9 and MMP7 which was associated with keratinocyte cell death.
27060293 Cross-talk between macrophages and smooth muscle cells impairs collagen synthesis and MMP1/9 activity, promoting angiogenesis.
27022952 Patients with primary Glioblastoma multiform with low MMP9 expression may have longer survival and may benefit from temozolomide chemotherapy.
26978018 The morphologically normal tissue adjacent to the tumor shows the substantial expression of MMP-2 and MMP-9 and in some cases the enhanced activity of uPA and ACE, which makes an additional contribution to the increased invasive potential of tumor
26973196 determined normal concentration ranges for MMP-1, MMP-2, MMP-9, TIMP-1, and ratios of concentrations of MMPs and TIMP-1 (MMP-1/TIMP-1, MMP-2/TIMP-1, MMP-9/TIMP-1) in the amniotic fluid at the first period of labor in physiological pregnancy.
26938614 Cerebrospinal GDF15, but not MMP9, may be a potential marker of Lewy body disorders.
26908323 High MMP9 expression is associated with colorectal cancer.
26901393 Ex Vivo and In Vivo Imaging and Biodistribution of Aptamers Targeting the Human Matrix MetalloProtease-9 in Melanomas.
More...

AA Sequence

MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPA      1 - 70
LLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDA     71 - 140
FARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELW    141 - 210
SLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQD    211 - 280
GNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFP    281 - 350
FTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY    351 - 420
PMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPS    421 - 490
AGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKW    491 - 560
PALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGR    561 - 630
RLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYD    631 - 700
ILQCPED                                                                   701 - 707
//

Text Mined References (2258)

PMID Year Title
27215085 2016 Expression Levels of MMP9 and PIWIL2 in Prostate Cancer: a Case-Control Study.
27089280 2016 Evaluation of New Diagnostic Biomarkers in Pediatric Sepsis: Matrix Metalloproteinase-9, Tissue Inhibitor of Metalloproteinase-1, Mid-Regional Pro-Atrial Natriuretic Peptide, and Adipocyte Fatty-Acid Binding Protein.
27078876 2016 Sphingomyelinase D from Loxosceles laeta Venom Induces the Expression of MMP7 in Human Keratinocytes: Contribution to Dermonecrosis.
27060293 2016 Cross-talk between macrophages and smooth muscle cells impairs collagen and metalloprotease synthesis and promotes angiogenesis.
27022952 2016 Comparative Analysis of Matrix Metalloproteinase Family Members Reveals That MMP9 Predicts Survival and Response to Temozolomide in Patients with Primary Glioblastoma.
26978018 [Matrix metalloproteinases 2 and 9, their endogenous regulators, and angiotensin-converting enzyme in cervical squamous cell carcinoma].
26973196 [Reference ranges of matrix metalloproteinase-1, -2, -9 and tissue inhibitor of matrix metalloproteinases-1 concentrations in amniotic fluid in physiological pregnancy].
26938614 2016 GDF15/MIC1 and MMP9 Cerebrospinal Fluid Levels in Parkinson's Disease and Lewy Body Dementia.
26908323 2016 A pilot study on faecal MMP-9: a new noninvasive diagnostic marker of colorectal cancer.
26901393 2016 Ex Vivo and In Vivo Imaging and Biodistribution of Aptamers Targeting the Human Matrix MetalloProtease-9 in Melanomas.
More...