1. Home
  2. Targets
  3. Neutrophil collagenase

Tchem Neutrophil collagenase

Can degrade fibrillar type I, II, and III collagens.

This gene encodes a member of the matrix metalloproteinase (MMP) family of proteins. These proteins are involved in the breakdown of extracellular matrix in embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Proteolysis at different sites on this protein results in multiple active forms of the enzyme with distinct N-termini. This protein functions in the degradation of type I, II and III collagens. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2015]

 Comments

Property Summary

NCBI Gene PubMed Count 170
PubMed Score 2172.36
PubTator Score 514.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
osteosarcoma 7933 7.3e-10
mucosa-associated lymphoid tissue lymphoma 480 1.0e-02

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -6.320 7.3e-10
mucosa-associated lymphoid tissue lympho... 5.318 1.0e-02

Synonym

Accession P22894 Q45F99
Symbols HNC
CLG1
MMP-8
PMNL-CL

Gene

MMP8

PDB

1A85   1A86   1BZS   1I73   1I76   1JAN   1JAO   1JAP   1JAQ   1JH1   1JJ9   1KBC   1MMB   1MNC   1ZP5   1ZS0   1ZVX   2OY2   2OY4   3DNG   3DPE   3DPF   3TT4   4QKZ  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (19)

See all...

 GO Function (4)

 GO Component (3)

 GO Process (4)

 Compartment GO Term (17)

See all...

 IMPC Phenotype (1)

 MGI Phenotype (3)

 GWAS Trait (1)

 HCA RNA Cell Line (19)

See all...

Pathway (10)

Protein-protein Interaction (1)

BCAN  

Ligand (874)

Structure of CHEMBL1160685

CHEMBL1160685
pIC50 6.00

Structure of CHEMBL95483

CHEMBL95483
pIC50 6.00

Structure of CHEMBL3221864

CHEMBL3221864
pIC50 6.00

Structure of CHEMBL3221863

CHEMBL3221863
pIC50 6.00

Structure of CHEMBL515083

CHEMBL515083
pIC50 6.00

Structure of CHEMBL291898

CHEMBL291898
pIC50 6.00

Structure of CHEMBL292636

CHEMBL292636
pIC50 6.00

Structure of CHEMBL141672

CHEMBL141672
pIC50 6.00

Structure of CHEMBL298814

CHEMBL298814
pIC50 6.00

Structure of CHEMBL170103

CHEMBL170103
pKi 6.00

Structure of CHEMBL172180

CHEMBL172180
pKi 6.00

Structure of CHEMBL3142592

CHEMBL3142592
pKi 6.00

Structure of CHEMBL1084509

CHEMBL1084509
pIC50 6.00

Structure of CHEMBL574589

CHEMBL574589
pIC50 6.00

Structure of CHEMBL122925

CHEMBL122925
pKi 6.00

Structure of CHEMBL3675553

CHEMBL3675553
pKi 6.03

Structure of CHEMBL1770700

CHEMBL1770700
pIC50 6.05

Structure of CHEMBL3670696

CHEMBL3670696
pKi 6.05

Structure of CHEMBL1234370

CHEMBL1234370
pIC50 6.06

Structure of CHEMBL3675575

CHEMBL3675575
pKi 6.06

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
2067 screening 9 / 0 / 0 Late stage results from the probe development efforts to identify inhibitors of Matrix Metalloproteinase-13 (MMP-13).

Gene RIF (138)

PMID Text
27442388 Suggest that MMP-8 polymorphism -799 C/T was a risk for developing chronic periapical lesions.
26872724 The reciprocal positive interplay between MMP-8 and TGF-beta1 contributes to HCC invasion and metastasis by inducing EMT mainly through the PI3K/Akt/Rac1 pathway.
26773532 EMMPRIN, MMP8, hyaluronan, beta-defensing-2, and neutrophil gelatinase-associated lipocalin (NGAL) are elevated in women with vaginal inflammation
26577236 Initial analysis of the MMP8 gene showed suggestive association between rs1940475 and knee OA, but the finding did not replicate in other study cohorts, even though the trend for predisposing allele was similar in all five cohorts. MMP-8 is a good biological candidate for OA, but our study did not find common variants with significant association in the gene.
26462905 amniotic fluid concentrations in acute-chorioamnionitis distinctly decrease throughout preterm-gestation
26418236 Sputum, serum, and urine MMP-8 were not significantly changed in COPD exacerbation compared to recovery values.
26339374 miR-539 plays a key role in inhibiting osteosarcoma cell invasion and migration and can regulate MMP8 expression in osteosarcoma cells.
26132583 salivary levels of the analyzed biomarkers MMP-8, -9, MPO are associated with periodontal status. However, these biomarkers could not differentiate between patients with or without a MI.
25841875 Positive results of the aMMP-8 test significantly correlate with generalized ChP. The aMMP-8 test may be used by physicians to detect periodontitis in their patients.
25712810 increased levels in saliva and serum in women with polycystic ovary syndrome, and is potentiated in the presence of gingivitis
25635689 Gender-specific analysis of MMPs demonstrated consistent increase in MMP-1 and -8 in tuberculosis, but MMP-8 was a better discriminator for TB in men.
25633268 Strong associations of MMP-8 with components of Metabolic Syndrome X in univariate, bivariate and multivariate models suggest plasma MMP-8 as a potential cardiometabolic risk marker for Metabolic syndrome X.
25607396 The expression of MMP-7, -8, -9 and -13 in the gingiva of the young patients with aggressive periodontitis and type 1 diabetes mellitus was positive in all studied cases.
25550459 investigated whether MMP-8 affects the structure and antiatherogenic function of apolipoprotein (apo) A-I, the main protein component of HDL particles
25545245 MMP-8, MMP-9, and YKL-40 might serve as novel non-invasive biomarkers of CF lung disease and pulmonary exacerbations.
25319807 patients with high serum MMP-8 levels may benefit from adjuvant IFN-alpha therapy, but this observation should be further investigated.
25109362 The 799C/T polymorphism in the promoter region of MMP8 may be associated with the development of TAD and that the T allele may increase patient predisposition to the disease.
25034366 MMP-8 promoter gene polymorphism -799 T/T is significantly associated with an increased risk of ovarian cancer in Mexican women.
25016699 Studied the plasma concentrations of MMP-8, TIMP1, C-reactive protein, fibrinogen, and WBCs in patients with acute coronary syndrome and found levels were significantly higher than those in the control group.
24828408 Plasma and BALF MMP-8 levels are unlikely to serve as a prognostic biomarker for IPF patients.
24651234 MMP-8 levels were possibly higher in 90-day nonsurvivors but performed poorly in predicting outcome
24283658 it can be suggested that MMP-8 -799 C/T and TIMP-1 372 T/C, *429 T/G gene polymorphisms in males may be associated with the susceptibility to GAgP in the Turkish population.
24267248 Plasmatic OxLDL and MMP-8 levels are associated with carotid atherosclerosis
24170307 MMP8 rs1940475 SNP modifies the host response to inflammatory stimuli.
24164993 Studied plasma MMP-8 levels and its correlates 20+/-3 months after acute myocardial infarction.
24099107 suggests that binding of the HGF variants to the cell surface c-Met resulted in the downregulation of MMP-9, and upregulation of MMP-8 protein expressions might be key molecular signals against proliferation, migration, and invasion of A549 cells
24065531 The C-799T polymorphism in the MMP8 promoter is part of the genetic variation underlying the susceptibility of individuals to the progression of thoracic aortic dissection.
23967183 Baseline serum MMP-8 is a significant predictor of LV remodeling and cardiovascular outcome after MI
23962148 Our results suggest that serum MMP-8, TIMP-1, and the ratio of MMP-9/TIMP-1 might be useful adjuncts as predictors of prognosis in patients with hepatocellular carcinoma
23953866 elevated levels of IL-6 and MMP-8 in amniotic fluid at mid-trimester are predictive of preterm delivery
23865360 Evaluated gingival inflammation and the enzyme activity of MMP-8 in gingival crevicular fluid of pregnant women. The aMMP-8 values of pregnant subjects were higher compared with non-pregnant, but the difference was not statistically significant.
23851938 Moderate-strength STS causes the highest TIMP-1/MMP-8 ratio, leading to appropriate conditions for reformation of the extracellular matrix
23851508 findings have shown that MMP-8 is able to modify the metastatic potential of breast cancer cells because of its ability to proteolytically cleave decorin and regulate miR-21 levels
23632023 a causal connection between MMP-8 activity and the IL-6/IL-8 network, with an acute response to MMP-8 involving induction of the proinflammatory mediators, which may in part serve to compensate for the deleterious effects of MMP-8 on breast cancer
23512982 Suggest that MMP8 plays an important role in angiogenesis in vitro and in vivo.
23442769 Low levels of plasma MMP8 levels can rule out acute aortic dissection.
23313321 Children with febrile infection have significantly elevated levels of serum MMP8 compared to children with unprovoked generalized seizures.
23259856 MMP-8 may be directly involved in hematopoietic stem cell mobilization and trafficking.
23054081 E-cadherin, EMMPRIN and MMP-8 median values were significantly increased in all chronic kidney disease children, as well as in all dialyzed patients versus controls
22808470 The content of MMP-8 an MMP-9 in oral fluid of patients with severe periodontium was slightly higher than that in other patients and subjects with the intact periodontium.
22487237 The polymorphism at position -799 of the gene for MMP-8 is associated with tendinopathy primary posterior tibial tendon in the population studied. The results suggest that individuals with the T allele are at greater risk of developing tendinopathy.
22382449 results suggest that polymorphism in the promoter region of MMP-8 gene is associated with early implant failure. This polymorphism can be a genetic marker to risk of implant loss.
22311494 Serum level of MMP-8 in the carotid vulnerable plaque group was higher than that in the carotid stable plaque group.
22257687 An increase of serum MMP-8 reflects plaque instability and tissue damage in acute coronary syndrome.
22179173 The preliminary results indicate that this polymorphism may be a risk factor for tendinopathy and could be used as a genetic marker for the primary lesions of the posterior tibial tendon.
22113040 The allele and genotype frequencies of MMP8 rs11225395 were not associated with the development of gastric cancer development and lymph node metastasis.
22092455 Multivariate logistic regression analysis with adjustment for age, gender and smoking indicated that increased risks of aggressive periodontitis and chronic periodontitis were associated with the -799 T allele of matrix metalloproteinase-8.
21994255 gene polymorphism is associated with atherosclerosis in Finland
21925226 genetic variations are associated with increased risk of ulcerative colitis in Caucasians of New Zealand
21920499 Although none of the investigated SNPs in the MMP8 gene was individually associated with periodontitis, specific haplotype showed association with clinical manifestation of chronic periodontitis in a Czech population.
21906737 MMP-8 promoter -381A/G and -799C/T gene polymorphisms could be risk factors for carotid atherosclerosis.
21872914 MMP-3, MMP-8, and MMP-9 levels were significantly different between patients with Hyper-IgE syndrome and control subjects and might contribute to some of the characteristic features of Hyper-IgE syndrome
21857935 Data show that higher MMP-8 and active MMP-9 levels at 48 hours of disease onset are associated with a longer duration of mechanical ventilation and fewer ventilator-free days among pediatric patients.
21784671 reduced risk on recurrence of superficial bladder cancer was observed in patients with MMP8 TT genotype
21697883 MMP-8 is involved in sensory nerve growth within the interstitial CoL matrix through modulation by the axonal guidance molecules and/or extracellular matrix components
21642878 Finding of this study indicates an influence of MMP8 gene variation on melanoma susceptibility.
21515330 We confirmed the decreased capacity of cell migration due to down-regulation of MMP-8 by apigenin.
21437624 Data indicate that the balance between MMPs and TIMPs in women with PCOS is altered, probably due to androgen excess found in these women.
21432777 differences in histological features between nasal polyposis and chronic rhinosinusitis might be related to the expression of MMP-1, MMP-2, MMP-8 and their tissue inhibitor-2
21196908 In patients with histological chorioamnionitis and funisitis, umbilical cord blood MMP-8 concentrations were not significantly changed.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20889295 Short-term use of statins is not associated in reducing levels of MMP 9 in areas of low and peak wall stress in patients with abdominal aortic aneurysms.
20809029 The MMP8 values in gingival crevicular fluid can be a marker of the gingival overgrowth onset.
20708200 MMP-8 could be involved in the acute inflammatory reaction and may be a useful marker for the diagnosis of acute thoracic aortic dissection (TAD).
20673868 Observational study of gene-disease association. (HuGE Navigator)
20659259 MMP-8 levels in oral rinse samples were higher in subjects with the strongest periodontal inflammatory burden than in subjects with less inflammatory changes when oral rinse levels were adjusted to number of teeth.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20626027 Compared and found plasma MMP-8 values were significantly higher in patients with carotid atherosclerosis compared with controls but did not differ signif'ly according to gender, smoking and hypertensive status, associated diseases, and use of statins.
20621951 Early treatment of multiple sclerosis with IFN-beta1b may stabilize clinical disease by attenuating level of MMP-8.
20587546 Observational study of gene-disease association. (HuGE Navigator)
20485444 Observational study of gene-disease association. (HuGE Navigator)
20484597 Observational study of gene-disease association. (HuGE Navigator)
20453486 Pleural fluid MMP-2, MMP-8 and MMP-9 may provide useful information for differentiating between uncomplicated and complicated parapneumonic effusions.
20452482 Observational study of gene-disease association. (HuGE Navigator)
20442866 MMP-8 activity plays a crucial role in disassembly of cell junction components and cell adhesion during meningococcal infection
20371206 Observational study of gene-disease association. (HuGE Navigator)
20356362 MMP-2 and -8 are elevated in serum and blister fluid in severe sepsis, implying that they may play a significant role in the pathogenesis of severe sepsis and organ dysfunctions
20184870 MMP-8 and -9 are highest in T2DM UA patients. MMP-9, showed the strongest associations with clinical parameters related to diabetic nephropathy.
20140262 Observational study of gene-disease association. (HuGE Navigator)
20042585 Soluble MMP-8 and membrane-bound MMP-8 on activated polymorphonuclear neutrophils can cleave and inactivate recombinant macrophage inflammatory protein-1 alpha in vitro.
19995403 Higher levels of MMP-8 were found in the gingival crevicular fluid of chronic periodontitis patients compared with controls, and these markers decreased 3 months after periodontal therapy.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19880617 Pneumolysin induces release of matrix metalloproteinase-8 and -9 from human neutrophils
19834535 Observational study of gene-disease association. (HuGE Navigator)
19751716 increased circulating MMP-8 and MMP-9 levels and proteolytic activity in periodontal disease patients that decrease after periodontal therapy
19745165 Results indicate that MMP8 is an important player in atherosclerosis.
19708869 Reverse transcriptase (RT)-PCR analysis revealed that Prevotella intermedia ATCC 25611 supernatant increased MMP-1 and MMP-8 mRNA expression in a concentration- and time-dependent manner.
19674746 plasma MMP-8 levels were found to be high in patients with unstable angina (UAP), suggesting that MMP-8 levels in UAP may reflect coronary plaque instability and that MMP-8 is a promising biomarker for UAP.
19527514 Observational study of gene-disease association. (HuGE Navigator)
19460733 Patients with coronary heart disease showed increased levels of MMP2 and MMP9.
19442604 Primary cultures stromal cells from giant cell tumour of bone produce MMP-1 and MMP-13 but not MMP-8..
19358835 Obese children and adolescents had higher circulating MMP-8 concentrations, lower plasma TIMP-1 concentrations, and higher MMP-8/TIMP-1 ratios than non obese controls.
19330028 Expression of wild-type but not mutant MMP8 in human melanoma cells inhibited growth on soft agar in vitro and tumor formation in vivo, suggesting that wild-type MMP-8 has the ability to inhibit melanoma progression.
19180518 Observational study of gene-disease association. (HuGE Navigator)
19159011 MMP-8 were identified at higher levels in lung secretions of pediatric ALI patients compared with controls.
19124506 Observational study of gene-disease association. (HuGE Navigator)
19094243 a C/G polymorphism in MMP8 was associated with a statistically significant decreased risk of developing lung cancer, but does not seem to modify or be an independent prognostic factor for overall survival
19094243 Observational study of gene-disease association. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)
19064570 Observational study of gene-disease association. (HuGE Navigator)
19019335 Observational study of gene-disease association. (HuGE Navigator)
18980523 Non-surgical periodontal treatment was effective in reducing the levels of MMP8 in gingival crevicular fluid from diabetic patients with chronic periodontitis.
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18768525 Functional polymorphisms in the promoter of MMP-8 do not significantly confer susceptibility to hepatocellular carcinoma in a southern Chinese population.
18768525 Observational study of gene-disease association. (HuGE Navigator)
18700005 In patients with high-risk bacteria, MMP-8-, MMP-9- and TIMP-1-concentrations were higher than in patients with low-risk bacteria.
18626311 high serum MMP-8 levels in melanoma patients were significantly related to presence of vascular invasion (P=0.001) in primary tumour, tumour ulceration (P=0.003) and tumour bleeding (P=0.033)
18428024 Total MMP-8 immunoreactivity, the proportion of active MMP-9, and gelatinolytic activity in urine were significantly higher in diabetic nephropathy patients than in controls
18366705 MMP8, but not MMP1 or MMP13, may affect the metastatic behaviour of breast cancer cells through protection against lymph node metastasis
18278188 In an in vitro atherosclerosis model neutrophil infiltration was mediated via IL-8-signalling and accompanied by release of MMP-8 and induction of endothelial cell apoptosis.
17974962 Observational study of gene-disease association. (HuGE Navigator)
17974962 MMP8 gene variation may influence breast cancer prognosis and support the notion that MMP8 has an inhibitory effect on cancer metastasis.
17932311 Serum MMP-8 concentrations are elevated in prevalent or subclinical atherosclerosis and associate with the worst cardiovascular outcome.
17728507 Observational study of gene-disease association. (HuGE Navigator)
17728507 Results show that -799C/T on the promoter region of MMP-8 lacks association with development of bronchiectasis in Koreans.
17584650 Data show that serum MMP-8 concentration is closely associated with ACS, particularly AMI, and may serve as an indicator for predicting ACS and AMI.
17567680 C-terminus of ephrin-B1 regulates activation of the extracellular release of MMP-8 without requirement of de novo protein synthesis.
17473191 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17418871 distinct deficits in NO production and elevations in MMP-8 and -9 expression in diabetic human skin fibroblasts compared to normal
17178858 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16940985 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16928431 Immunofluorescence intensity, representing MMP-8 expression, in the periodontal tissues of smokers (30 fields from 6 subjects, mean 1154+/-124 units) was significantly higher than that in the periodontal tissues of non-smokers.
16877349 The expression of matrix-modeling genes in chronic idiopathic myelofibrosis (cIMF) is not influenced by the JAK2 mutation status but is predominantly related to the stage of disease.
16872847 findings show that bacterial vaginosis is associated with increased levels of matrix metalloproteinase-8(MMP-8) in vaginal fluid
16432074 A localized increase in MMP-8 and -9, mediated by native mesenchymal cells, presents a potential pathway for collagen breakdown and abdominal aortic aneurysm rupture.
16259988 MMP-8 has a role in carotid plaque progression
16242329 x-ray crystallographic analysis reveals that in a complex with MMP-8, N-hydroxyurea binds the catalytic zinc ion in a monodentate rather than bidentate mode and with high out-of-plane distortion of the amide bonds
16134994 significantly elevated sinus mucus levels associated with elevated IL-8 levels in chronic rhinosinusitis with nasal polyposis (CRSwNP); IL-8 and MMP-8 seemingly form an inductive cytokine-proteinase cascade in CRSwNP pathogenesis
15888067 Significantly elevated metalloproteinase 8 in broncho-alveolar lavage fluid is associated with Bronchiolitis obliterans
15661397 in the later stages of myeloid development, MMP8 and other SGP genes are coordinately upregulated, and members of the C/EBP family, in particular C/EBPalpha and C/EBPepsilon, play specific and unique roles in upregulating their expression
15367487 Observational study of gene-disease association. (HuGE Navigator)
15367487 Functionally significant single nucleotide polymorphisms of the MMP8 promoter haplotypes and preterm premature rupture of membranes were evaluated.
15187163 membrane-bound MMP-8 on PMN cleaves types I and II collagens, and alpha(1)-proteinase inhibitor, but is substantially resistant to inhibition by tissue inhibitor of metalloproteinase-1 (TIMP-1) and TIMP-2.
15042023 Matrix metalloproteinase-8 is produced primarily by chorionic cells in human fetal membranes, and the level of matrix metalloproteinase-8 protein and messenger RNA expression in fetal membranes increases during labor.
14550288 gelatinase B and neutrophil collagenase cleave MIG and IP-10
12117418 MMP-8 cleaves TFPI following Ser(174) within the connecting region between the second and third Kunitz domains
12101112 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
11731274 expression in normal and malignant melanocytic cells

AA Sequence 

MFSLKTLPFLLLLHVQISKAFPVSSKEKNTKTVQDYLEKFYQLPSNQYQSTRKNGTNVIVEKLKEMQRFF      1 - 70
GLNVTGKPNEETLDMMKKPRCGVPDSGGFMLTPGNPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELW     71 - 140
SVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTNTSANYN    141 - 210
LFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYGLSSNPIQPTGPSTPKPCD    211 - 280
PSLTFDAITTLRGEILFFKDRYFWRRHPQLQRVEMNFISLFWPSLPTGIQAAYEDFDRDLIFLFKGNQYW    281 - 350
ALSGYDILQGYPKDISNYGFPSSVQAIDAAVFYRSKTYFFVNDQFWRYDNQRQFMEPGYPKSISGAFPGI    351 - 420
ESKVDAVFQQEHFFHVFSGPRYYAFDLIAQRVTRVARGNKWLNCRYG                           421 - 467
//

Text Mined References (170)

PMID Year Title
27442388 2015 Matrix Matalloproteinase-8 Gene Polymorphism in Chronic Periapical Lesions.
26872724 2016 Reciprocal activation between MMP-8 and TGF-?1 stimulates EMT and malignant progression of hepatocellular carcinoma.
26773532 2016 Vaginal Inflammation: Association between Leukocyte Concentration and Levels of Immune Mediators.
26577236 2016 Association study of MMP8 gene in osteoarthritis.
26462905 2015 The inflammatory milieu of amniotic fluid in acute-chorioamnionitis decreases with increasing gestational age.
26418236 2016 Matrix metalloproteinases -8 and -9 in the Airways, Blood and Urine During Exacerbations of COPD.
26339374 2015 MicroRNA-539 suppresses osteosarcoma cell invasion and migration in vitro and targeting Matrix metallopeptidase-8.
26132583 2015 Salivary Matrix Metalloproteinase-8 and -9 and Myeloperoxidase in Relation to Coronary Heart and Periodontal Diseases: A Subgroup Report from the PAROKRANK Study (Periodontitis and Its Relation to Coronary Artery Disease).
25841875 2015 Activated matrix metalloproteinase-8 in saliva as diagnostic test for periodontal disease? A case-control study.
25712810 2015 Elevated matrix metalloproteinase-8 in saliva and serum in polycystic ovary syndrome and association with gingival inflammation.
25635689 2015 Gender-dependent differences in plasma matrix metalloproteinase-8 elevated in pulmonary tuberculosis.
25633268 2015 Evaluation of plasma MMP-8, MMP-9 and TIMP-1 identifies candidate cardiometabolic risk marker in metabolic syndrome: results from double-blinded nested case-control study.
25607396 2014 Matrix metalloproteinase -7, -8, -9 and -13 in gingival tissue of patients with type 1 diabetes and periodontitis.
25550459 2015 Matrix metalloproteinase 8 degrades apolipoprotein A-I and reduces its cholesterol efflux capacity.
25545245 2014 Identification of neutrophil activation markers as novel surrogate markers of CF lung disease.
25319807 2015 Benefit of adjuvant interferon alfa-2b (IFN-?) therapy in melanoma patients with high serum MMP-8 levels.
25109362 2014 Association between -799C/T single nucleotide polymorphism of the MMP?8 promoter region and thoracic aortic dissection.
25087078 2014 Genetic determinants of common epilepsies: a meta-analysis of genome-wide association studies.
25034366 2014 Matrix metalloproteinase-8 promoter gene polymorphisms in Mexican women with ovarian cancer.
25016699 2014 The measurement of circulating matrix metalloproteinase-8 and its tissue inhibitor and their association with inflammatory mediators in patients with acute coronary syndrome.
24828408 2014 Mononuclear phagocytes and airway epithelial cells: novel sources of matrix metalloproteinase-8 (MMP-8) in patients with idiopathic pulmonary fibrosis.
24651234 2014 Serum MMP-8 and TIMP-1 in critically ill patients with acute respiratory failure: TIMP-1 is associated with increased 90-day mortality.
24283658 2014 Matrix metalloproteinase (MMP)-8 and tissue inhibitor of MMP-1 (TIMP-1) gene polymorphisms in generalized aggressive periodontitis: gingival crevicular fluid MMP-8 and TIMP-1 levels and outcome of periodontal therapy.
24267248 2013 Oxidized low-density lipoprotein, matrix-metalloproteinase-8 and carotid atherosclerosis in spinal cord injured subjects.
24170307 2014 MMP-8 genotypes influence the inflammatory response in human endotoxemia.
24164993 2013 Relation of plasma matrix metalloproteinase-8 levels late after myocardial infarction with left ventricular volumes and ejection fraction.
24099107 2013 Regulatory expression of MMP-8/MMP-9 and inhibition of proliferation, migration and invasion in human lung cancer A549 cells in the presence of HGF variants.
24065531 2013 Impact of matrix metalloproteinase-8 gene variations on the risk of thoracic aortic dissection in a Chinese Han population.
23967183 2013 Serum MMP-8: a novel indicator of left ventricular remodeling and cardiac outcome in patients after acute myocardial infarction.
23962148 2013 Prognostic value of serum MMP-8, -9 and TIMP-1 in patients with hepatocellular carcinoma.
23953866 2013 Identification of biomarkers for preterm delivery in mid-trimester amniotic fluid.
23865360 2013 Clinical parameters and aMMP-8-concentrations in gingival crevicular fluid in pregnancy gingivitis.
23851938 2014 Induction of IL-6 and MMP-8 in human periodontal fibroblasts by static tensile strain.
23851508 2014 The anti-metastatic activity of collagenase-2 in breast cancer cells is mediated by a signaling pathway involving decorin and miR-21.
23632023 2013 Matrix metalloproteinase 8 (collagenase 2) induces the expression of interleukins 6 and 8 in breast cancer cells.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23512982 2013 An important role of matrix metalloproteinase-8 in angiogenesis in vitro and in vivo.
23442769 2013 Rule out of acute aortic dissection with plasma matrix metalloproteinase 8 in the emergency department.
23313321 2013 Matrix-metalloproteinases and proinflammatory cytokines in children with febrile convulsions and epilepsy--cause or consequence?
23259856 2013 Release of matrix metalloproteinase-8 during physiological trafficking and induced mobilization of human hematopoietic stem cells.
23154389 2013 Regulation of endodermal differentiation of human embryonic stem cells through integrin-ECM interactions.
23054081 2013 New markers of apoptosis in children on chronic dialysis.
22808470 2011 Content of matrix metalloproteinase-8 and matrix metalloproteinase-9 in oral fluid of patients with chronic generalized periodontitis.
22487237 2014 MMP-8 polymorphism is genetic marker to tendinopathy primary posterior tibial tendon.
22382449 2013 Influence of MMP-8 promoter polymorphism in early osseointegrated implant failure.
22311494 2012 [Association between matrix metalloproteinase-8 -799C/T polymorphism and instability of carotid plaque].
22257687 2013 The balance of serum matrix metalloproteinase-8 and its tissue inhibitor in acute coronary syndrome and its recurrence.
22179173 2011 Association of MMP-8 polymorphisms with tendinopathy of the primary posterior tibial tendon: a pilot study.
22113040 2011 [Study on association between single nucleotide polymorphisms of MMP7, MMP8, MMP9 genes and development of gastric cancer and lymph node metastasis].
22092455 2011 MMP-8 -799 C>T genetic polymorphism is associated with the susceptibility to chronic and aggressive periodontitis in Taiwanese.
21994255 2012 Single nucleotide polymorphism -799C/T in matrix metalloproteinase-8 promoter region in arterial disease.
21925226 2011 Genetic variations in matrix metalloproteinases may be associated with increased risk of ulcerative colitis.
21920499 2012 Matrix metalloproteinase 8 (MMP8) gene polymorphisms in chronic periodontitis.
21906737 2011 Association of MMP-8 promoter gene polymorphisms with carotid atherosclerosis: preliminary study.
21872914 2011 Plasma metalloproteinase levels are dysregulated in signal transducer and activator of transcription 3 mutated hyper-IgE syndrome.
21857935 2011 Early elevation of matrix metalloproteinase-8 and -9 in pediatric ARDS is associated with an increased risk of prolonged mechanical ventilation.
21784671 2013 Association of single nucleotide polymorphisms in promoter of matrix metalloproteinase-2, 8 genes with bladder cancer risk in Northern India.
21697883 2011 Matrix metalloproteinase-8 is involved in dermal nerve growth: implications for possible application to pruritus from in vitro models.
21642878 2011 Association of MMP8 gene variation with an increased risk of malignant melanoma.
21515330 2011 A mechanism of apigenin-induced apoptosis is potentially related to anti-angiogenesis and anti-migration in human hepatocellular carcinoma cells.
21437624 2011 Imbalanced circulating matrix metalloproteinases in polycystic ovary syndrome.
21432777 2011 Distribution of matrix metalloproteinases MMP-1, MMP-2, MMP-8 and tissue inhibitor of matrix metalloproteinases-2 in nasal polyposis and chronic rhinosinusitis.
21196908 2010 Umbilical cord blood concentrations of IL-6, IL-8, and MMP-8 in pregnancy complicated by preterm premature rupture of the membranes and histological chorioamnionitis.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20889295 2011 A randomized placebo controlled trial of the effect of preoperative statin use on matrix metalloproteinases and tissue inhibitors of matrix metalloproteinases in areas of low and peak wall stress in patients undergoing elective open repair of abdominal aortic aneurysm.
20809029 2010 Correlations between the gingival crevicular fluid MMP8 levels and gingival overgrowth in patients with fixed orthodontic devices.
20708200 2010 The prominent expression of plasma matrix metalloproteinase-8 in acute thoracic aortic dissection.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20659259 2011 Oral rinse MMP-8 point-of-care immuno test identifies patients with strong periodontal inflammatory burden.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20626027 2010 Plasma levels of matrix metalloproteinase-8 in patients with carotid atherosclerosis.
20621951 2010 Alterations in serum MMP-8, MMP-9, IL-12p40 and IL-23 in multiple sclerosis patients treated with interferon-beta1b.
20587546 2010 Interferon gamma receptor 2 gene variants are associated with liver fibrosis in patients with chronic hepatitis C infection.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20484597 2010 Association of matrix metalloproteinase gene polymorphisms with refractive error in Amish and Ashkenazi families.
20453486 2010 Matrix metalloproteinase levels in the differentiation of parapneumonic pleural effusions.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20442866 2010 Neisseria meningitidis induces brain microvascular endothelial cell detachment from the matrix and cleavage of occludin: a role for MMP-8.
20371206 2010 Plasma level of tissue inhibitor of matrix metalloproteinase-1 but not that of matrix metalloproteinase-8 predicts survival in head and neck squamous cell cancer.
20356362 2010 Matrix-metalloproteinase-2, -8 and -9 in serum and skin blister fluid in patients with severe sepsis.
20184870 2010 Urinary matrix metalloproteinase-8 and -9 activities in type 2 diabetic subjects: A marker of incipient diabetic nephropathy?
20140262 2010 Maternal and fetal genetic associations of PTGER3 and PON1 with preterm birth.
20042585 2010 Matrix metalloproteinase-8 inactivates macrophage inflammatory protein-1 alpha to reduce acute lung inflammation and injury in mice.
19995403 2010 Gingival crevicular fluid levels of MMP-8, MMP-9, TIMP-2, and MPO decrease after periodontal therapy.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19880617 2009 Pneumolysin induces release of matrix metalloproteinase-8 and -9 from human neutrophils.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19751716 2009 Circulating matrix metalloproteinase-8 (MMP-8) and MMP-9 are increased in chronic periodontal disease and decrease after non-surgical periodontal therapy.
19745165 2009 A role of matrix metalloproteinase-8 in atherosclerosis.
19708869 2009 Prevotella intermedia upregulates MMP-1 and MMP-8 expression in human periodontal ligament cells.
19674746 2010 High plasma levels of matrix metalloproteinase-8 in patients with unstable angina.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19460733 2009 [Plasma matrix metalloproteinases-2 and -9 levels are elevated in patients with acute coronary syndrome and coronary chronic total occlusion].
19442604 2009 Collagenase expression and activity in the stromal cells from giant cell tumour of bone.
19358835 2009 Assessment of matrix metalloproteinase (MMP)-2, MMP-8, MMP-9, and their inhibitors, the tissue inhibitors of metalloproteinase (TIMP)-1 and TIMP-2 in obese children and adolescents.
19330028 2009 Analysis of the matrix metalloproteinase family reveals that MMP8 is often mutated in melanoma.
19180518 2009 Associations of 25 structural, degradative, and inflammatory candidate genes with lumbar disc desiccation, bulging, and height narrowing.
19159011 2009 Matrix metalloproteinase activity in pediatric acute lung injury.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19094243 2008 Polymorphism +17 C/G in matrix metalloprotease MMP8 decreases lung cancer risk.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19064570 2008 Missense polymorphisms in matrix metalloproteinase genes and skin cancer risk.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
18980523 2008 The short-term effectiveness of non-surgical treatment in reducing levels of interleukin-1beta and proteases in gingival crevicular fluid from patients with type 2 diabetes mellitus and chronic periodontitis.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18768525 2008 No association of MMP-7, MMP-8, and MMP-21 polymorphisms with the risk of hepatocellular carcinoma in a Chinese population.
18700005 2008 Hospital acquired pneumonia with high-risk bacteria is associated with increased pulmonary matrix metalloproteinase activity.
18626311 2008 Serum matrix metalloproteinase-8 is associated with ulceration and vascular invasion of malignant melanoma.
18428024 2008 Urinary matrix metalloproteinase -8, -9, -14 and their regulators (TRY-1, TRY-2, TATI) in patients with diabetic nephropathy.
18366705 2008 Plasma MMP1 and MMP8 expression in breast cancer: protective role of MMP8 against lymph node metastasis.
18278188 2008 Subendothelial infiltration of neutrophil granulocytes and liberation of matrix-destabilizing enzymes in an experimental model of human neo-intima.
17974962 2007 Association of matrix metalloproteinase-8 gene variation with breast cancer prognosis.
17932311 2007 Serum matrix metalloproteinase-8 concentrations are associated with cardiovascular outcome in men.
17728507 2007 Lack of association between matrix metalloproteinase 8 promoter polymorphism and bronchiectasis in Koreans.
17584650 2007 [Implications of serum matrix metalloproteinase-8 elevation in patients with acute coronary syndrome].
17567680 2007 The C-terminus of ephrin-B1 regulates metalloproteinase secretion and invasion of cancer cells.
17473191 2007 Matrix metalloproteinase polymorphisms are associated with bladder cancer invasiveness.
17418871 2007 Nitric oxide donors selectively reduce the expression of matrix metalloproteinases-8 and -9 by human diabetic skin fibroblasts.
17178858 2006 Matrix metalloproteinase polymorphisms and bladder cancer risk.
16940985 2006 Clinical impact of MMP and TIMP gene polymorphisms in gastric cancer.
16928431 2006 Increased local matrix metalloproteinase-8 expression in the periodontal connective tissues of smokers with periodontal disease.
16877349 2006 Aberrant collagenase expression in chronic idiopathic myelofibrosis is related to the stage of disease but not to the JAK2 mutation status.
16872847 2006 Vaginal matrix metalloproteinase levels in pregnant women with bacterial vaginosis.
16432074 2006 Matrix metalloproteinase-8 and -9 are increased at the site of abdominal aortic aneurysm rupture.
16259988 2006 Intraplaque MMP-8 levels are increased in asymptomatic patients with carotid plaque progression on ultrasound.
16242329 2006 N-Hydroxyurea as zinc binding group in matrix metalloproteinase inhibition: mode of binding in a complex with MMP-8.
16192646 2005 Trypsin-2 degrades human type II collagen and is expressed and activated in mesenchymally transformed rheumatoid arthritis synovitis tissue.
16134994 2005 In vivo relationship between collagenase-2 and interleukin-8 but not tumour necrosis factor-alpha in chronic rhinosinusitis with nasal polyposis.
15888067 2005 Broncho-alveolar lavage matrix metalloproteases as a sensitive measure of bronchiolitis obliterans.
15661397 2005 Human neutrophil collagenase expression is C/EBP-dependent during myeloid development.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15367487 2004 Functionally significant SNP MMP8 promoter haplotypes and preterm premature rupture of membranes (PPROM).
15187163 2004 Membrane-bound matrix metalloproteinase-8 on activated polymorphonuclear cells is a potent, tissue inhibitor of metalloproteinase-resistant collagenase and serpinase.
15042023 2004 Matrix metalloproteinase-8 is expressed in human chorion during labor.
14550288 2003 Carboxyterminal cleavage of the chemokines MIG and IP-10 by gelatinase B and neutrophil collagenase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12149192 2002 Matrix metalloproteinase processing of monocyte chemoattractant proteins generates CC chemokine receptor antagonists with anti-inflammatory properties in vivo.
12117418 2002 Structural and functional characterization of tissue factor pathway inhibitor following degradation by matrix metalloproteinase-8.
12101112 2002 Interaction of collagen-related genes and susceptibility to betel quid-induced oral submucous fibrosis.
12054629 2002 ADAMTS1 cleaves aggrecan at multiple sites and is differentially inhibited by metalloproteinase inhibitors.
11731274 2001 Neutrophil collagenase (MMP-8) is expressed during early development in neural crest cells as well as in adult melanoma cells.
11400153 2001 In vivo collagenase-2 (MMP-8) expression by human bronchial epithelial cells and monocytes/macrophages in bronchiectasis.
10986281 2000 Brevican is degraded by matrix metalloproteinases and aggrecanase-1 (ADAMTS4) at different sites.
10949161 2000 Structural differences of matrix metalloproteinases. Homology modeling and energy minimization of enzyme-substrate complexes.
10922468 2000 Matrix metalloproteinases 19 and 20 cleave aggrecan and cartilage oligomeric matrix protein (COMP).
10859319 2000 Matrix metalloproteinases cleave tissue factor pathway inhibitor. Effects on coagulation.
10419448 1999 Matrix metalloproteinases.
10353844 1999 The N-terminus of collagenase MMP-8 determines superactivity and inhibition: a relation of structure and function analyzed by biomolecular interaction analysis.
9737711 1998 Matrix metalloproteinases: structures, evolution, and diversification.
9688535 1998 Membrane-type 1 MMP (MMP-14) cleaves at three sites in the aggrecan interglobular domain.
9655333 1998 Structure of malonic acid-based inhibitors bound to human neutrophil collagenase. A new binding mode explains apparently anomalous data.
9578462 1998 Activation of the precursor of human stromelysin 2 and its interactions with other matrix metalloproteinases.
9249047 1997 1.8-A crystal structure of the catalytic domain of human neutrophil collagenase (matrix metalloproteinase-8) complexed with a peptidomimetic hydroxamate primed-side inhibitor with a distinct selectivity profile.
9042108 1997 Matrix metalloproteinases, tumor necrosis factor and multiple sclerosis: an overview.
8921407 1996 Fine physical mapping of the human matrix metalloproteinase genes clustered on chromosome 11q22.3.
8639592 1996 Amino acid sequence and carbohydrate structure of a recombinant human tissue factor pathway inhibitor expressed in Chinese hamster ovary cells: one N-and two O-linked carbohydrate chains are located between Kunitz domains 2 and 3 and one N-linked carbohydrate chain is in Kunitz domain 2.
8631924 1996 Chondrocyte matrix metalloproteinase-8. Human articular chondrocytes express neutrophil collagenase.
8307185 1994 Structural implications for the role of the N terminus in the 'superactivation' of collagenases. A crystallographic study.
8216228 1993 Fibroblast and neutrophil collagenases cleave at two sites in the cartilage aggrecan interglobular domain.
8137810 1994 The X-ray crystal structure of the catalytic domain of human neutrophil collagenase inhibited by a substrate analogue reveals the essentials for catalysis and specificity.
7998967 1994 Neutrophil collagenase (MMP-8) cleaves at the aggrecanase site E373-A374 in the interglobular domain of cartilage aggrecan.
7656015 1994 Structure of human neutrophil collagenase reveals large S1' specificity pocket.
2176876 1990 Characterization of 58-kilodalton human neutrophil collagenase: comparison with human fibroblast collagenase.
2169766 1990 Partial amino-acid sequence of human PMN leukocyte procollagenase.
2169256 1990 Partial amino acid sequence of human PMN leukocyte procollagenase.
2164002 1990 Human neutrophil collagenase. A distinct gene product with homology to other matrix metalloproteinases.
2159879 1990 Characterization and activation of procollagenase from human polymorphonuclear leucocytes. N-terminal sequence determination of the proenzyme and various proteolytically activated forms.
1662606 1991 Mercurial activation of human polymorphonuclear leucocyte procollagenase.
1646048 1991 Structure and expression of the cDNA encoding human neutrophil collagenase.
1330697 1992 Formation of a covalent Hg-Cys-bond during mercurial activation of PMNL procollagenase gives evidence of a cysteine-switch mechanism.