Property Summary

Ligand Count 211
NCBI Gene PubMed Count 398
PubMed Score 1017.78
PubTator Score 722.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
interstitial lung disease 2.700 1.6e-02
active Crohn's disease 1.777 4.9e-02
active ulcerative colitis 2.412 5.0e-03
Atopic dermatitis 1.300 1.4e-02
Breast cancer -4.000 6.8e-13
breast carcinoma -1.200 1.5e-08
chronic kidney disease 2.600 9.3e-03
cystic fibrosis 1.700 1.5e-03
ependymoma 1.100 6.6e-03
esophageal adenocarcinoma 1.900 3.3e-02
gastric carcinoma 3.600 2.1e-02
head and neck cancer and chronic obstruc... 1.100 4.3e-02
lung adenocarcinoma 2.200 4.5e-08
lung carcinoma -1.300 1.6e-03
malignant mesothelioma 1.600 8.2e-06
non-small cell lung cancer 1.061 6.7e-03
ovarian cancer 3.600 1.2e-04
pancreatic cancer 2.000 7.0e-04
pancreatic ductal adenocarcinoma liver m... 3.441 1.7e-02
pediatric high grade glioma 1.100 1.7e-02
periodontitis 1.500 2.1e-23
primary Sjogren syndrome 1.800 5.3e-03
psoriasis -1.500 6.6e-05
urothelial carcinoma -3.600 1.4e-04

PDB (11)

Gene RIF (372)

AA Sequence

MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPI      1 - 70
TGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEI     71 - 140
PLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLY    141 - 210
AATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK                 211 - 267
//

Text Mined References (398)

PMID Year Title