Property Summary

NCBI Gene PubMed Count 371
PubMed Score 960.59
PubTator Score 722.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
interstitial lung disease 2.700 1.6e-02
urothelial carcinoma -3.600 1.4e-04
malignant mesothelioma 1.600 8.2e-06
esophageal adenocarcinoma 1.900 3.3e-02
psoriasis -1.800 6.4e-08
posterior fossa group A ependymoma 1.300 4.8e-03
periodontitis 1.500 2.1e-23
Atopic dermatitis 1.300 1.4e-02
chronic kidney disease 2.600 9.3e-03
pancreatic ductal adenocarcinoma liver m... 3.441 1.7e-02
non-small cell lung carcinoma 2.100 2.4e-14
active Crohn's disease 1.777 4.9e-02
ulcerative colitis 3.600 4.5e-06
pancreatic cancer 2.000 7.0e-04
cystic fibrosis 1.700 1.5e-03
lung adenocarcinoma 2.200 4.5e-08
pediatric high grade glioma 1.100 1.7e-02
primary Sjogren syndrome 1.800 5.3e-03
lung carcinoma -1.300 1.6e-03
breast carcinoma -1.200 1.5e-08
Breast cancer -4.000 6.8e-13
gastric carcinoma 3.600 2.1e-02
ovarian cancer 3.600 1.2e-04
head and neck cancer and chronic obstruc... 1.100 4.3e-02

Gene RIF (348)

PMID Text
27078876 Data show that spider venom sphingomyelinase D increased expression/secretion of MMP2, MMP9 and MMP7 which was associated with keratinocyte cell death.
27069188 The multivariate stepwise logistic regression identified the following biomarkers as the best gastric cancer predictors: CEA, CA72-4, pepsinogen I, Helicobacter pylori presence and MMP7
26906940 Urinary MMP7 improves the overall diagnostic performance of urinary CXCL10 for distinguishing normal histology from subclinical and clinical inflammation/injury, but not subclinical inflammation alone.
26792722 Our data suggested a potential role of Rab11-FIP2 in tumor progression and provided novel insights into the mechanism of how Rab11-FIP2 positively regulated cell migration and invasion in CRC cells.
26652716 Expression of MMP2 and MMP7 in gastric cancer is not associated with mTOR, MMP9 expression might be related to mTOR signalling in a subset of tumors
26648518 These findings demonstrate that Tan-IIA inhibits the migration ability of AGS human gastric cancer cells and that decreasing the protein expression of NF-kappaB-p65, COX-2, and MMP-2, -7 and -9 may be an underlying molecular mechanism
26520416 MMP-7 expression is highly specific, though only of moderate sensitivity, for the diagnosis of carcinoma in the differential diagnosis from both benign and malignant mesothelial cells.
26507660 PKD2 is a core factor in the formation of this multiprotein complex at the TGN that controls constitutive secretion of matrix metalloproteinase cargo.
26464654 Protein, mRNA, and serum expression levels of MMP-7 and IL-15 in patients with osteoarthritis were all significantly increased in osteoarthritis patients compared with the control group.
26457789 Data suggest MMP7 (matrix metalloproteinase 7) in follicular fluid cleaves proNGF (pro-nerve growth factor) in ovarian follicle; both MMP7 and proNGF appear to be products of granulosa cells; processing of proNGF to NGF appears to regulate apoptosis.
26418251 Data showed that AEG1 and MMP7 levels were both significantly increased and strongly correlated in non-small cell lung cancer (NSCLC) tissues. AEG-1 promotes NSCLC cell invasiveness through MAPK-p42/p44-dependent activation of MMP7.
26412030 Data suggest that, in type 2 diabetes complicated by kidney disease, up-regulation of urinary MMP7 is strongly associated with progression to end-stage renal disease/subsequent mortality; study was conducted in public hospitals in Los Angeles County.
26408312 The expression of KAI1/CD82, CD44, MMP7 and beta-catenin is related to tumor metastasis and prognosis in colorectal carcinoma.
26402225 Study shows that MiR-543 inhibits translation of MMP7 through binding to the 3'-UTR of MMP7 mRNA in ovarian cancer. PLGF suppresses miR-543, which activates MMP7-mediated cancer invasion.
26330178 In a Chinese population, genetic polymorphisms in MMP7 were associated with risk of coal workers pneumoconiosis.
26301605 For the MMP7 -181 A/G polymorphism, a decreased bladder cancer risk was found (G-allele vs. A-allele.
26229436 increased expression levels of MMP-7 may be related to an advanced TNM stage, lower differentiation grade, aggressive invasive grade, and lymph node metastasis in esophageal cancer
26214021 Data show that 5-hydroxytryptamine receptor (5-HT1DR) played an important role in cell invasion via Axin1/beta-catenin/matrix metalloproteinase 7 (MMP-7) pathway.
26164539 The ELM7 assay was specific towards in vitro MMP-7 degraded elastin.
26116564 Molecular switch from NOX1 to NOX2 in colon cancer cells induces ROS production and subsequently enhances MMP-7 expression by deactivating AMPK.
25919283 Results from the meta-analysis indicated a significant poor prognostic effect of matrix metalloproteinase-7 in gastric cancer survival. Additionally it was associated with aggressive tumor phenotype.
25901368 the expression of WNT4, a Wnt ligand, and three targets of Wnt-ss-catenin transcription activation, namely, MMP7, cyclinD1 (CD1) and c-MYC in 141 penile tissue cores from 101 unique samples, were investigated.
25875355 The results suggest that MMP7 over-expression may be one of the mechanisms by which PKP3 loss leads to increased cell invasion and tumor formation.
25847246 Nicotine shows an additive effect over MMP7 GG genotype toward gastric cancer risk.
25823818 MMP-7 upregulation in response to shear stress exposure has the ability to promote lung colonization of chondrosarcomas in vivo.
25676403 EFEMP1 suppresses growth and invasion of lung cancer cells by downregulating MMP7 expression.
25607396 The expression of MMP-7, -8, -9 and -13 in the gingiva of the young patients with aggressive periodontitis and type 1 diabetes mellitus was positive in all studied cases.
25588786 Our meta-analysis results revealed that MMP-7 overexpression is associated with advanced TNM and histological grades, and is linked to aggressive LN metastasis in lung cancer patients.
25579141 The present study revealed a significant association of MMP-7 -181A/G (rs11568818) GG genotype with chronic pancreatitis patients, indicating its possible association with the disease.
25549795 It was demonstrated that the pretreatment concentration of proMMP-1 may be clinically useful when evaluating the mass of the tumor, whereas MMP-7 may be a prognostic factor for DFS in men with rectal cancer without distant metastasis
25368272 High serum MMP7 level is associated with cholangiocarcinoma.
25357219 Report CD34/MMP7 expression and invasiveness in early colorectal neoplasms using narrow band imaging and immunohistochemistry.
25338725 Colorectal tumor patients with Reg4- and MMP-7-positive tumors had extremely poor overall survival.
25330950 Our findings thus reveal Nrdp1, EGFR signaling, and MMP7 as promising therapeutic targets for preventing the metastasis of colorectal cancer .
25321193 High mmp7 expression is associated with chemotherapy resistance in colorectal cancer.
25300296 MMP-2, MMP-9, MMP-7 and TIMP-2 were upregulated in primary spontaneous pneumothorax lesions.
25263962 the proliferation of HBSMCs induced by stretch was resulted from the stretch-induced MMPs expression and release.
25123263 MMP-7 mRNA levels were increased in lymph node metastasis-positive gastric carcinoma.
25091573 High MMP7 expression is associated with metastasis of hepatocellular carcinoma.
25063248 There was an interaction between two alleles of MMP-7 G and MMP-9 T that significantly increased the risk of severe preeclampsia by 1.4-fold
25008564 these findings suggest that EGF/EGFR signaling induces FoxO1 nuclear exclusion, which activates MMP7 to promote larynx carcinoma metastasis
24981249 our data suggest that miRNA-34 inhibits EGFR signaling to regulate MMP7 expression in gastric carcinoma
24980707 MMP7 serum levels are increased in women exposed to biomass combustion.
24930385 Increased immunoreactivity of MMP-7 and local caseinolytic activity were found in neoplastic cells but not in stromal cells.
24903600 Cell surface lipid attachment of human MMP7 differentially modulates proteolytic activity.
24847890 MMP7 expression and MMP7 promoter methylation may be useful as prognostic biomarkers. Furthermore, MMP7 expression and promoter methylation analysis may be effective mechanisms to distinguish basal-like breast cancers from other triple-negative subtypes.
24833109 We conclude that enzymatic processing of perlecan in the BM or territorial matrix by MMP-7 as occurs in the invasive tumor microenvironment acts as a molecular switch to alter PCa cell behavior and favor cell dispersion and invasiveness.
24755685 MMP-7 and nestin may be beneficial as markers, given their sensitivity to gastrointestinal stromal tumors.
24704993 findings indicate that increased expression of MMP-7 is associated with lymph node metastasis and upregulated by COX-2, and promotes the tumorigenesis of LAC
24632608 this study identified a novel role of the cleavage form of NCL generated by MMP7 in stabilizing MMP9 mRNA.
24624896 regulator of beta-catenin function in injured lung epithelium
24615104 The results showed that MMP7-181A/G and MMP13-77A/G variants were associated with Colorectal cancer
24613844 Taken together, these data suggest that IL-1alpha regulates extracellular domain shedding of syndecan-2 through regulation of the MAP kinase-mediated MMP-7 expression in colon cancer cells.
24469951 Increased level of MMP7 resulted in the enhanced drug resistance in colorectal cancer.
24425843 MMP7 increases with dysplasia and cancer disease stage in tumour tissue as well as in the regional lymph nodes. It may be used as a complement in investigating suspected locally advanced cancer
24400123 MMP-7 could contribute to plaque instability in carotid atherosclerosis, potentially involving macrophage-related mechanisms.
24283384 MMP7 was found to be a direct and functional target of miR-148a.
24270662 These results suggest a possible contribution of IL-24 to squamous cell carcinoma invasion via enhancing focal expression of MMP7.
24261884 GAD1 expression correlates with cellular invasiveness and migration by regulating beta-catenin translocation and MMP7 activation.
24143235 functional upregulation of secreted-MMP7 is associated to the loss of PTEN
24048760 Molecular expression of MMP-7, laminin c2 or EGFR, and their combinations, may be associated with gastric cancer tumor aggressiveness
24043512 the effect of common MMP1 1G/2G, MMP3 5A/6A, MMP7 -181A>G, MMP9 R279Q, and MMP12 -82A>G polymorphisms on atherosclerotic plaque presence may be site- and sex-dependent
23953525 Polymorphisms of MMP7 and MMP20 genes may be surrogate markers to predict long-term outcomes after kidney transplantation.
23895900 MMP7 -181GG genotype is associated with overall cancer risk in Asian populations.
23893803 No significant relationship was observed between the MMP-1 -1607 1G/2G alleles and genotypes and the risk of gastric cancer.
23867815 HIV-1 gp120-treated vaginal epithelial cells show upregulation of matrix metallopeptidase 7 (MMP7) expression as compared to untreated control
23807291 MMP-7 and MMP-9 immunostaining was significantly different between pathological and normal discs and correlated with the extent of histopathological degeneration.
23803888 Inhibition of BCMO1 expression is associated with increased invasiveness of colon cancer cells and increased expression of MMP7 and MMP28. beta-Carotene can upregulate BCMO1 and reverse these effects.
23790336 The abnormal expressions of COX-2 and MMP-7 are closely related to the biological behavior of oral squamous cell carcinoma.
23783374 Patients with high cilium gene expression demonstrate more microscopic honeycombing, but not fibroblastic foci, and have elevated tissue expression of tracheobronchial mucin 5 protein and Matrix Metalloproteinase 7.
23725125 MMP-7 (-181A>G) polymorphism is associated with digestive system cancer risk.
23682078 Increased expression of MMP7 is associated with colorectal cancer.
23671562 Data indicate that Il-9 and IL-13 regulate expressions of MUC5AC, SPDEF and matrix metalloproteinase 7 (MMP-7) in pediatric bronchial epithelial cell.
23644699 Promoter polymorphism of matrix metalloproteinase 7 is associated with digestive cancer.
23562717 The MMP-7 (-181A>G) polymorphism was associated with higher cancer risk.
23437250 miR-126&126* restored expressions play a tumor suppressor role by directly regulating ADAM9 and MMP7 in melanoma.
23344661 MMP7 probably enhances myofibroblast proliferation and luminal lesion expansion in acute Kawasaki disease vasculopathy.
23343931 Data indicate that MMP-1 and MMP-3 expressed predominated in synovia, whereas MMP-12 expression was higher in rheumatoid nodules, and higher MMP-7 expression in nodules that featured infiltrating monocyte/macrophage-producing MMP-7 protein.
23300791 Ascl1 directly regulates expression of matrix metalloproteinase-7 and O(6)-methylguanine-DNA methyltransferase.
23249718 Data indicate that the plasma protein levels of MMP-7 in lung cancer patients were significantly higher than those in healthy control subjects.
23076342 High MMP7 expression is associated with prostate cancer.
23065739 Data indicate that a serum biomarker panel consisting of CA19-9, cathepsin D, and MMP-7 may provide the most effective screening test currently feasible for Pancreatic ductal adenocarcinoma.
22974215 MMP7 is a novel target of EpCAM signalling.
22957785 upregulation of MMP-7 contributed by REG 4 protein
22957090 SPARC suppresses angiogenesis of gastric cancer by down-regulating the expression of VEGF and MMP-7
22944341 Reduced PTEN expression and MMP-7 over-expression may play important roles in the pathogenesis of colorectal cancer.
22936257 confirms the importance of MMP-1, 7, 9, and 12 in the development of preeclampsia
22883281 Mean matrix metalloproteinase-7 levels were lower in multiple sclerosis patients compared with controls and increased significantly in the treated group
22645431 H. pylori-infected gastric ulcers express higher MMP-7, MMP-9, and TIMP-1 than NSAID-related ulcers
22645147 Findings identify MMP7 as a novel mechanism through which FOXC1 may regulate the basal-like breast cancer invasive phenotype and the propensity of these cancers to metastasize.
22631636 study found positive expression of MMP- 7 in colorectal cancer (CRC) tissues was higher than that in distal normal mucosa; poor histological differentiation, advanced clinical stage and lymph node metastasis were correlated with MMP-7 expression in CRC
22621753 This study suggests that genetic variants in MMP-2,7,9 and TIMP-2genes are associated with higher susceptibility of gallbladder cancer.
22582975 The influence of transforming growth factor-alpha, cyclooxygenase-2, matrix metalloproteinase (MMP)-7, MMP-9 and CXCR4 proteins involved in epithelial-mesenchymal transition on overall survival of patients with gastric cancer.
22524815 High MMP-7 is associated with malignant pleural effusion.
22417142 These findings have suggested that MMP-7 polymorphism might be associated with the risk and progression of COPD in the Turkish population.
22368250 Human matrix metalloproteinase 7 (MMP-7) activity exhibits broad bell-shaped pH profile with the acidic and alkaline pK(a) (pK(e1) and pK(e2)) values of about 4 and 10.
22292085 The identification of MMP7 as a direct SOX18 target gene as well as other potential candidates including guidance molecules provides a molecular basis for the proposed function of this transcription factor in the regulation of vessel formation.
22268124 These results suggest that increased sensitivity of the polymorphic matrix metalloproteinase 7 promoter to FOXA2 provides one of the genetic bases for the upregulation of matrix metalloproteinase 7 in idiopathic pulmonary fibrosis.
22246095 Obtained results indicate a possible relationship between -181 A/G polymorphism of the MMP-7 gene and malignant transformation of colorectal epithelial cells and progression of colorectal cancer.
22227189 the data suggest that MMP-7 directly mediates shedding of syndecan-2 from colon cancer cells.
22215634 Matrilysin expression in RD may be an injury response that disrupts normal nephrogenesis by impairing BMP-7 signaling.
22200690 Failed to demonstrate any prognostic relevance of MMP7 levels in advanced epithelial ovarian neoplasms.
22131018 It was found that PRL-3 induced MMP-7 through oncogenic pathways including PI3K/AKT and ERK and that there is a relationship between the expression of PRL-3 and MMP-7 in human tumor cell lines.
22113040 The allele and genotype frequencies of MMP7 rs11568818 were not associated with the development of gastric cancer development and lymph node metastasis.
22095947 levels of renal MMP-7 correlate with Wnt/beta-catenin activity.
22089237 Data show that elevated levels of matrix metalloproteinase-7 (MMP7) and a disintegrin and metalloproteinase-12 (ADAM12) in alpha(1a)-247R-expressing cells are responsible for EGF receptor (EGFR) transactivation.
22076613 A novel TF/FVIIa/MAPK/c-Fos/MMP-7 axis plays an important role in modulating the invasion of colon cancer cells.
22051851 Matrix metalloproteinase 7, TIMP-1, and TIMP-2 were significantly increased in cervicovaginal fluid during labor.
22047080 MMP7 -181A/G polymorphism is associated with cancer development.
22042554 findings suggest PB inhibits MMP-7 expression epigenetically through phosphoacetylation of histone proteins, and thereby, reduced invasive ability of an ATC thyroid cancer cell line
22024063 Overexpression of MMP-7 generally indicated a higher metastatic potential and inferior overall survival of adenocarcinoma of colon and rectum.
21999204 correlation between MSLN and MMP-7 in the progression of ovarian cancer, and the mechanism of MSLN in enhancing ovarian cancer invasion
21981819 Antisense oligonucleotide targeting matrix metalloproteinase-7 (MMP-7) changes the ultrastructure of human A549 lung adenocarcinoma cells, inhibiting proliferation and invasion.
21935919 plasma HYP, collagen I and MMP-7 may be useful as novel predictive markers of opisthorchiasis-related BBD, and HYP may be used as a diagnostic marker for CCA
21912055 MMP-7 (-181A>G) GG carriers are at a higher risk of esophageal squamous cell carcinoma in Kashmir valley.
21901248 fibulin-3 negatively modulates the invasiveness of lung cancer cells via regulation of MMP-7 and MMP-2 and its expression is regulated by hypermethylation of the promoter region
21858178 Data show that decidualization was associated with increased expression of 428 genes including SCARA5 (181-fold), DKK1 (71-fold) and PROK1 (32-fold), and decreased expression of 230 genes including MMP-7 (35-fold) and SFRP4 (21-fold).
21814482 The increased MMP-7 expression due to H2O2 treatment of SW620 cells was mediated by activation of MAP kinases in an AP-1-dependent manner. Dimerumic acid inhibits AP-1-mediated MMP-7 gene transcription.
21787888 Thermodynamic analysis of ionizable groups involved in the catalytic mechanism of human matrix metalloproteinase 7.
21764478 High levels of MMP-7 in tumor cells and high levels of MMP-9 in tumor associated stroma were independent positive prognostic factors in NSCLC patients.
21722074 MMP7 -181A/G polymorphism is associated with the development of vulnerable carotid plaques
21707759 The median MMP-7 serum level of systemic sclerosis patients with lung fibrosis (LF) was significantly higher compared with those without LF.
21593056 These results suggest thatactive-site tyrosyl residue, Tyr219 of the matrix metalloproteinase 7 is not critical for catalytic activity, but is involved in the broad pH-dependence of the activity.
21517234 Homozygous variant GG genotype of MMP-7 (-181A>G) polymorphism was associated with a more than two fold increased risk of gastric cancer.
21516345 The aim of this study was to evaluate serum concentrations of sFas, sFasL, and their potential regulators (MMP-2, MMP-7, MMP-9, TIMP-1, TIMP-2), in children and young adults chronically dialyzed.
21481787 demonstrate that serum MMP7 level in human patients with pancreatic ductal adenocarcinoma correlated with metastatic disease and survival
21455340 MMP-7 may have a role in esophageal squamous cell carcinoma
21336735 There was significant difference in IL-8 -251TT and MMP-7 -181GG genotypes between the cervical cancer group and the lymph node metastasis group. Individuals with IL-8 T or MMP-7 G carriers were at significantly higher risk of cervical cancer.
21315773 These results suggest that the induction of MMP-7 by Tax is regulated by JunD and that MMP-7 could facilitate visceral invasion in adult T-cell leukemia .
21302026 There is marked relationship between matrix metalloproteinase 7 and brain atrophy in HIV infection.
21255765 direct association observed between morphological scores of malignancy and MMP immunoreactivity, with the association being significant for MMP-7. present results demonstrate important role of MMPs in development of SCCs of lower lip and tongue.
21165404 We revealed a positive correlation between serum levels of MMP-7 in patients with primary ovarian cancer and the size of the primary tumor
21116502 The concentration of MMP-7 was maximum in the blood of patients with tumor invasion in lymph vessels. These data suggest MMP-7 as a possible serological marker of gastric cancer.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20979817 In the serum of patients with idiopathic pulmonary fibrosis, the level of MMP-1 was lower but the level of MMP-7 higher than in patients with sarcoidosis.
20939893 Up-regulation of MMP-7 expression through beta2-AR-mediated signaling pathway is involved in invasion and metastasis of gastric cancer.
20872971 Serum values of MMP7 and CA19-9 appear to be useful biomarkers for differentiating cholangiocarcinoma from benign biliary tract obstructive diseases.
20853162 NGAL may be considered a novel stress protein, whereas MMP-7, MMP-9, and TIMP-1 may be regarded as indicators of stress response in the pediatric population on chronic dialysis
20827277 Observational study of gene-disease association. (HuGE Navigator)
20826916 study provided new support for the association of MMP1-1607 and MMP7-181 in bladder cancer development, the tumorigenic effect of which was observed to be more enhanced in case of tobacco exposure
20826916 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20813660 PKD3 may contribute to the malignant progression of prostate cancer cells through negative regulation of MMP-7 expression.
20736794 Tissue present at the site of hypertrophic nonunions commonly expresses significantly higher levels of MMP-7 and MMP-12 in relation to mineralized fracture callus.
20730428 Observational study of gene-disease association. (HuGE Navigator)
20707923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20680712 High MMP7 expression was confirmed to be an independent prognostic factor of colon cancer
20673868 Observational study of gene-disease association. (HuGE Navigator)
20662554 investigation of the association of single-nucleotide polymorphism at MMP-1 16071G/2G, MMP-7 181A/G, and MMP-9 279R/Q genes with colorectal cancer in the southwest Chinese Han population
20662554 Observational study of gene-disease association. (HuGE Navigator)
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20624652 chronic disordered epithelial expression of MMP-7 in patients with asthma might increase mFasL cleavage and contribute to airway epithelial damage and inflammation.
20605794 Cholesterol sulfate alters substrate preference of matrix metalloproteinase-7 and promotes degradations of pericellular laminin-332 and fibronectin.
20605361 The A/G genotype had a significant association with recurrence-free survival in postprostatectomy patients & the frequency of the risk-reducing genotype A/A was 74% whereas that of the risk-enhancing genotypes A/G & G/G were 20% & 6%
20605361 Observational study of gene-disease association. (HuGE Navigator)
20587546 Observational study of gene-disease association. (HuGE Navigator)
20584750 Enhanced expression of MMP-7 is associated with progression from non-dysplastic Barrett's oesophagus to adenocarcinoma.
20491537 role of these proteins in the process of invasion and metastasis cannot be ruled out since their presence is more marked along the tumor invasion front compared to more central areas of squamous cell carcinoma of the tongue
20484597 Observational study of gene-disease association. (HuGE Navigator)
20473942 Elevated serum matrix metalloproteinase 7 levels are associated with metastatic prostate cancer.
20452482 Observational study of gene-disease association. (HuGE Navigator)
20375326 Increased expression of MMP7 was the only consistent differentially regulated gene in the conjunctival samples of trichiasis subjects.
20372795 MMP-7 and SGCE are distinctive molecular factors in sporadic colorectal cancers from the mutator phenotype pathway
20360147 MMP7 -181 AG and GG genotype carriers had an increased gastric cancer risk
20360147 Meta-analysis of gene-disease association. (HuGE Navigator)
20359117 The positive rates of Ang-2 and MMP-7 were significantly higher in laryngeal carcinoma tissue than those in adjacent non-cancerous tissue. Patients with positive expression of Ang-2 had worse overall survival.
20347338 Genetic polymorphisms of MMP7 predispose to development of bronchiolitis obliterans (BOS). Patients carrying these risk alleles express lower levels of MMP-7, which may contribute to aberrant tissue repair and culminate in development of BOS.
20347338 Observational study of gene-disease association. (HuGE Navigator)
20300917 MMP-7 overexpression is associated with lymph node and distant metastases as well as with prognosis of gastric cancer
20230842 Observational study of gene-disease association. (HuGE Navigator)
20219015 MMP-10 and -7 abundance increased, accompanied by decreased TIMP-4 in dilated cardiomyopathy failing hearts compared with non-failing hearts.
20192597 Observational study of genotype prevalence. (HuGE Navigator)
20180812 MMP-7 is a promising marker to detect present and to predict future metastasis in bladder cancer
20156184 MMP-7 was used for the screening secretory metalloproteinase inhibitors in conditioned media of human cancer cell cultures. Human epidermoid carcinoma conditioned media demonstrated the most intense band in reverse-zymography and in Western blotting.
20146992 Increased circulating MMP-7 might indicate enhanced adipocyte differentiation in subjects who had undergone bariatric surgery.
20139113 MMP-7 is involved in the cleavage of N-cadherin and modulates vascular smooth muscle cell apoptosis, and may contribute to atherosclerotic plaque development and rupture.
20132413 Data show that genes overexpressed in ovarian/peritoneal carcinoma including MMP7.
20113256 The MMP-7 -181 A/G genotype is a potential factor for susceptibility to endometrial cancer.
20113256 Observational study of gene-disease association. (HuGE Navigator)
20096949 we have identified novel relationships between serum MMP-7 and diabetic complications specifically in renal disease and in diastolic dysfunction.
20040080 although the level of MMP7 secretion was the highest in the secretory phase the difference from the proliferative phase did not reach statistical significance
20007614 MMP-7 protein expression in epithelial cells was significantly higher in red peritoneal lesions compared with that of deep infiltrating endometriosis, ovarian endometriosis and black peritoneal lesions, in all phases of the menstrual cycle.
19929564 MMP-7 is associated with the prognosis of patients with acinic cell and mucoepidermoid carcinoma.
19834535 Observational study of gene-disease association. (HuGE Navigator)
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19787626 Immunoexpression of metalloproteinase-7 does not correlate with recurrence, mortality, relapse-free survival, survival, degree of cell differentiation, or staging of colorectal cancer.
19785773 endocrine therapy is an efficient therapy for inhibiting ERbeta-positive colon cancer cell proliferation and migration via down-regulation of MMP7.
19730683 Observational study of gene-disease association. (HuGE Navigator)
19728912 MMP-7 and survivin are related to the generation of colon cancer, and are independent factors for prognosis of colon cancer.
19724852 positive expression of both CD44v6 and MMP-7, and negative expression of nuclear Cdx2 may serve as powerful predictors of lymph node metastasis in gastric cancer
19701966 Results suggest that laminin (LN)gamma2 and LNbeta3, in conjunction with MMP7, play a key role in the progression of biliary tract cancer.
19690958 Concomitant elevations of MMP-3 and MMP-7 serum levels in the H. pylori-infected gastric cancer patients could serve as potential biomarkers to correlate with poor survival.
19690403 increased expression in interstitial pneumonia
19682489 Cellular senescence of human mammary epithelial cells (HMEC) is associated with an altered MMP-7/HB-EGF signaling and increased formation of elastin-like structures.
19679556 The selective inhibition of MMP-7 in the tumor-bone microenvironment may be of benefit for the treatment of lytic breast-to-bone metastases.
19676133 A novel nonsynonymous variant of matrix metalloproteinase-7 confers risk of liver cirrhosis.
19676133 Observational study of gene-disease association. (HuGE Navigator)
19654318 These observations demonstrate that sulfated GAGs regulate matrilysin activation from promatrilysin and its activity against specific substrates.
19643940 SNPs in MMP1, MMP2, MMP7 and MMP12 have roles in response to chemotherapy in lung cancer
19643940 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19634113 E-cadherin and metalloproteinase-1 and -7 polymorphisms have roles in colorectal cancer
19634113 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19608871 matrilysin-1 may play an important role in the bronchiolization of alveoli by promoting proliferation, migration, and attenuation of apoptosis involving multiple genes in the MAP kinase pathway.
19596921 Significantly higher expression of MMP-7 and MMP-9 in tumor tissue than in the surrounding tissue or in benign lung disease tissue supports the notion of an important role of these metalloproteinases in the growth of lung carcinoma
19586554 SFRP5 is downregulated and inversely correlated with MMP-7 and MT1-MMP in gastric cancer
19505922 The fecal RNA test using COX-2 and MMP-7 mRNAs improved the sensitivity to detect colorectal cancer without decreasing the specificity
19465902 Hepatocellular adenoma was characterized by the complete absence of matrix metalloproteinase-7 expression
19435861 none of 30 haplotype tagging polymorphisms in MMP-1, MMP-3, and MMP-7 were found to be significantly associated with endometrial cancer risk.
19421758 Elevated expressions of MMP7, TROP2, and survivin are associated with survival, disease recurrence, and liver metastasis of colon cancer.
19420105 Observational study of gene-disease association. (HuGE Navigator)
19360357 Three-dimensional culture using a radial flow bioreactor induces matrix metalloprotease 7-mediated EMT-like process in tumor cells via TGFbeta1/Smad pathway.
19329997 MMP7 coordinates allergic lung inflammation by activating interleukin 25 while simultaneously inhibiting retinoid-dependent development of regulatory T cells.
19317620 Helicobacter pylori CagA-positive patients carrying MMP-7 -181 G allele had a higher risk for lymphoid follicle formation.
19317620 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19303106 Observational study of gene-disease association. (HuGE Navigator)
19266094 MMP7 is related to the acquisition of oxaliplatin-resistance and its inhibition restores drug sensitivity by increasing Fas receptor.
19231585 Hyaluronan synthase (HAS2 and HAS3) and hyaluronan may mediate cellular invasion via changes in MMP-7 expression in SW620 colon carcinoma cells.
19221016 These findings indicate that MMP7-catalyzed release of heparin-binding EGF-like growth factor mediates acetylcholine induced transactivation of epithelial growth factor receptors and consequent proliferation of colon cancer cells
19181662 Differential Processing of {alpha}- and {beta}-Defensin Precursors by Matrix Metalloproteinase-7 (MMP-7).
19173304 cleavage of CLEC3A by MMP-7 weakens the stable adhesion of
19132754 Observational study of gene-disease association. (HuGE Navigator)
19121849 metastasis and survival of patients with bladder cancer are mediated, at least in part, by matrix metalloproteinase-7
19094228 Observational study of gene-disease association. (HuGE Navigator)
19022775 RECK is cleaved by MMP-2 and MMP-7 and competitively inhibits MMP-7-catalyzed cleavage of fibronectin
19020757 Serous and mucinous ovarian tumors express different profiles of MMP-7.
19016757 MMP7 gene expression was significantly higher in colorectal cancer patients than in healthy volunteers.
19000448 High concentration of tamoxifen can inhibit the proliferation of ERbeta-positive HT-29 cells, and effectively bind with ERbeta to down-regulate MMP-7 expression.
18974372 VEGF escapes the sequestration by endothelial sVEGFR-1 and promotes angiogenesis in the presence of MMP-7.
18958543 In Japan, carriage of the MMP-7-181 G allele and of the CMA/B A allele were each associated with an increased risk for H. pylori-related noncardia gastric cancer development.
18958543 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18955490 Identification of amino acid residues of matrix metalloproteinase-7 essential for binding to cholesterol sulfate.
18931651 metalloproteinase-7 expression was associated with more aggressive buccal squamous cell carcinomas
18823373 the expression level of MMP-7 in tumor cells is predictive of response to chemotherapy and outcome in patients with advanced NSCLC receiving platinum-based chemotherapy.
18805052 Gene expression revealed up-regulation of pro-angiogenic (PGF), anti-apoptotics (BAG-1, BCL-2), heart development (TNNT2, TNNC1) and extracellular matrix remodelling (MMP-2, MMP-7) genes in SM.
18798254 common MMP-7 genetic polymorphisms may have roles in survival among Chinese women with breast cancer
18798254 Observational study of gene-disease association. (HuGE Navigator)
18768525 Functional polymorphisms in the promoter of MMP-7 do not significantly confer susceptibility to hepatocellular carcinoma in a southern Chinese population.
18768525 Observational study of gene-disease association. (HuGE Navigator)
18721140 It is supposed that the cleavage of cell surface annexin II by matrilysin contributes to tumor invasion and metastasis by enhancing tPA-mediated pericellular proteolysis by cancer cells.
18715618 The matrix metalloproteinase-7 gene may be up-regulated by mutated or continuously elevated beta-catenin protein in sporadic desmoid tumors.
18713744 MMP7 and MMP9-mediated cleavage of EphB2 is induced by receptor-ligand interactions at the cell surface and that this event triggers cell-repulsive responses
18695873 activin A may modulate the expression of MMP-7 via AP-1
18674869 beta-catenin expression was significantly related to E-cadherin and MMP-7 expression
18653469 p120 and Kaiso regulate Helicobacter pylori-induced expression of matrix metalloproteinase-7
18648013 Results from our study suggest that common MMP-7 genetic polymorphisms may contribute to breast cancer susceptibility
18644839 MMP-7 cleaves the NR1 subunit of the N-methyl-d-aspartate (NMDA) receptor to generate an N-terminal fragment of approximately 65 kDa
18636198 Higher matrix metallopeptidase 7 is associated with colorectal cancer.
18600430 HRG-beta-induced MMP-7 expression was regulated by HER2-mediated AP-1 activation in MCF-7 cells.
18548257 MMP7 may act as a downstream mediator of FVIIa/TF signal transduction to facilitate the development of metastasis in colon cancer.
18511876 E1AF mRNA overexpression correlated well with matrilysin expression in rectal cancers.
18500535 MMP7 may contribute to the process by which intraductal papillary mucinous neoplasm (IPMN) of the pancreas advances from adenoma to carcinoma and to subsequent invasion of tumor cells in IPMN.
18485588 HLE may be a natural inactivator of MMP-7 which can counteract MMP-7-induced apoptosis resistance.
18448157 Individuals with MMP-7 -181GG genotype are at significantly higher risk of cervical cancer.
18448157 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18447576 MMP7 and MMP1, are overexpressed in the lung microenvironment and distinguish idiopathic pulmonary fibrosis from other chronic lung diseases. Additionally, increased MMP7 concentration may be indicative of asymptomatic ILD and reflect disease progression.
18422740 Increased plasma MMP-7 is associated with metastatic disease in patients with renal cell carcinomas
18411043 HER2-dependent transcriptional upregulation and protein secretion of MMP-7 are mediated by activated STAT3.
18385523 TIMP-1 interacts with matrix metalloproteinases and regulates matrilysin activity during airway epithelial repair.
18364512 reduced extracellular proteolytic activity of certain matrix metalloproteinases-for example, MMP-7-is associated with accelerated aging and senescence in normal HMECs.
18340552 matrilysin may be multiple, multifarious, and multifaceted functions contributing to early tumor growth
18329694 Expression of MMP-7 in cholangiocarcinoma is an unfavorable postoperative prognostic factor of cholangiocarcinoma arising from the large bile ducts. Underexpression of MMPs in papillary cholangiocarcinoma might be associated with a favorable prognosis.
18308831 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18214300 Immunoassays showed significantly elevated content of matrix metalloproteinase 7 in tumors compared to adjacent histologically unchanged mucosa of patients with colorectal cancer.
18202161 Circulating Pro-MMP-7 is associated with IgG specific to pro-MMP-7 in patients with renal cell carcinomas
18179407 the significantly increased expression of MMP7 in primary CNS lymphoma (PCNSL), suggest the involvement of this MMP in the characteristic infiltration pattern of PCNSL.
18036564 evidence that matrix metalloproteinase-7 (MMP-7) interacts with anionic, cationic and neutral lipid membranes, although it interacts strongest with anionic membranes.
18023162 MMP-7 is involved in tumor angiogenesis, thereby contributing to malignant growth and hence associated with decreased survival
18006768 Observational study of gene-disease association. (HuGE Navigator)
17728005 Wnt1 may play a critical role in regulating the intratumoral MMP-7 expression
17718429 MMP-7 expression in human rectal cancer increases significantly and plays a key role in the invasion and metastasis of human rectal cancer.
17695544 MMP-7 gene expression is associated with increased risk only for early stages of oral cancer.
17672933 MMP-7 -181A/G polymorphism may influence the susceptibility to astrocytoma.
17672933 Observational study of gene-disease association. (HuGE Navigator)
17671679 VEGF, MMP2, 7 and 9, and COX-2 expression is related to progression of advanced uterine cervical cancer in young women
17607721 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17564313 Expression of MMP7 was evaluated in hepatocellular carcinoma and surrounding non-tumor tissue.
17554258 Diminished expression of MMP-7 may play a role in fibronectin accumulation in the diabetic kidney in response to advanced glycation end products and/or TGF-beta.
17507989 The expression of MMP7 was specifically enhanced at the bronchiolo-alveolar duct junction and suggests that MMP7 plays a key role during the bronchioalveolar remodeling.
17502620 reveal the MMP7-activated photodynamic therapy efficacy of this photodynamic molecular beacons
17487834 MMP-7 is an independent prognostic factor for survival in advanced colorectal cancer. In our sample, the risk of death associated to MMP-7 increase is much higher than the risk of death associated to lactate dehydrogenase elevation
17396032 incubation with HGF mediated the release of MMP-7, resulting in extracellular cleavage of E-cadherin from stomach cancer cells
17373931 Observational study of gene-disease association. (HuGE Navigator)
17310281 MMP-7-selective targeting to the plasma membrane of epithelial cells promotes its activity by conferring resistance to TIMP-2.
17219436 MMP-7 has a role in invasiveness of glioma
17209789 MMP-7 is associated with the innate host defense in periodontal tissues.
17153464 Our results suggested the importance of MMP-7 and MT1-MMP in the peritoneal metastases of gastric cancer.
17145868 Data show that MMP7 and LN5 are coexpressed in colonic carcinoma cells HT29 cells.
17145820 MMP-7 influences tumor progression by regulating invasion and angiogenesis. Multivariate analysis showed that MMP-7 status of cancer tissues was strong predictor of poor prognosis. MMP-7 targeting treatment may be a potential target against human RCC.
17129995 A significant increase in the proportion of MMP 7 immunopositive cells was seen in the nucleus pulposus of discs classified as showing intermediate levels of degeneration and a further increase was seen in discs with severe degeneration.
17125518 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17114341 MMP-7 secretion/activation may represent a new mechanism that facilitates ovarian cancer invasion.
17038551 Estrogen modulates tight junctional resistance through estrogen receptor-alpha-mediated remodeling of occludin
17029196 Data show that MMP7 may be relevant with carcinogenesis, development and metastasis of adenoid cystic carcinoma, and different metastasis potential may result from different subtype of MMPs gene family.
17009258 These data demonstrate that CD151 is overexpressed in osteoarthritic cartilage and suggest that CD151 plays a role in the pericellular activation of proMMP-7, leading to cartilage destruction and/or chondrocyte cloning.
17009118 Matrix metalloproteinase-7 overexpression is thought to be an early event in the colonic adenoma-carcinoma pathway.
16956593 Observational study of gene-disease association. (HuGE Navigator)
16956593 The present result, for the first time, suggested that the MMP-7-181A/G polymorphism might be associated with the susceptibility to adult astrocytoma.
16940985 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16804904 intense MMP-7 signal in tumor cells is an independent prognostic factor predicting better survival in epithelial ovarian cancer
16494848 FGF-2-induced MMP7 expression in endothelium depends on AP-1 and FGF-2 signaling to AP-1 involves a Stat1/3-dependent pathway.
16476739 it is likely that binding of matrilysin to cholesterol sulfate facilitates the matrilysin-catalyzed modulation of cell surface proteins, thus inducing the cancer cell aggregation
16474379 Data suggest that tissue expression of MMP-7 could be a useful marker to predict the progression and metastasis of hepatocellular carcinoma.
16474169 Fas downregulation and a consequential increased resistance to FasL-triggered apoptosis resulting from upregulated MMP-7 in colorectal cancer cells could be a key mechanism for their escape from the immune surveillance
16455621 The 181A/G polymorphism in MMP7 has a potential to be a susceptibility factor for endometriosis and adenomyosis.
16455621 Observational study of gene-disease association. (HuGE Navigator)
16405530 Observational study of gene-disease association. (HuGE Navigator)
16356191 Observational study of gene-disease association. (HuGE Navigator)
16286510 shed syndecan-1 or MMP7-syndecan-1 complexes may have roles in tumor progression
16278009 Observational study of gene-disease association. (HuGE Navigator)
16248458 In chronic rhinosinusitis and nasal polyps tissues the expression of TGF-beta1, MMP-7, MMP-9, TIMP-1 protein was significant increased compared to controls.
16142384 Increased expression of MMP-7 in high grade uterine endometrial carcinoma (UEC) may be associated with tumor invasion and metastasis, and MMP-7 could serve as a prognostic maker in UEC.
16115946 Study suggests that targeting matrilysin may have important therapeutic implications.
16097959 MMP7 immunoreactivity was present in only polymyositis not dermatomyositis
15979995 sFasL and matrilysin are expressed in seminal plasma and have a role in regulation of the function of the Fas system
15930031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15930031 Polymorphism might be a candidate marker for predicting individuals who are at higher risk to certain tumors but might not be used to predict potential of lymphatic metastasis in various cancers.
15866216 expression up-regulated in Helicobacter species-infected colon and bile duct epithelial cells and hepatocytes.
15860507 Some green tea catechins induce pro-MMP-7 production via O2- production and the activation of JNK1/2.
15809719 Activation of MMP-7 protein closely involved in disruption of tight junction structure and consequent induction of cell dissociation as well as invasion in pancreatic cancer
15800927 results suggest E1A-F is overexpressed in early stages of human CRC development and may be an important factor in the overexpression of COX-2 and MMP-7
15725655 We assessed mRNA expression of MMPs in six human colorectal cancer cell lines and found a considerable level of MMP-7 expression in HT-29 cells.
15696117 Results imply that MMP-7 is a major MMP associated with the tissue remodeling during the progression of liver fibrosis in biliary atresia.
15652345 pattern of secretion in polarized MDCK cells expressing stably transfected human MMP-7
15618645 alcohols are considered to bind the hydrophobic S1' subsite most plausibly, and the size of the pocket was estimated to be large enough to accommodate the length of 1-butanol (4-carbon chain) and the bulk of tertiary alcohols
15523695 These results indicate MMP-7 is overexpressed in malignant ovarian epithelium and suggest MMP-7 may facilitate tumor cell invasion in vivo partly through the induction of progelatinase activation.
15375490 Overexpression of MMP-7 is associated with non-small cell lung cancer
15239678 the importance of MMP7 as a predictor of secondary Extramammary Paget's disease or the putative origin of Paget's cells from the dermal adenocarcinoma cells of apocrine duct origin
15149334 matrilysin may have a role in renal tubular injury and progression of tubulointerstitial fibrosis, and Wnt4 may regulate matrilysin expression in the kidney
15102692 matrix metalloproteinase-7 has a role in progression of pancreatic cancer
15040016 Heparanase, CD44v6 and nm23 may play important roles in the invasive infiltration and lymph node metastasis in gastric carcinomas.
14744783 May contribute to the tumorigenesis of MMP-7-producing IGF-IR-expressing tumors in the primary site and to organ-specific metastasis in a paracrine manner
14516315 Down-regulated PTEN expression and up-regulated MMP-7 expression were greatly implicated in tumorigenesis and progression of gastric carcinoma.
12963695 Data show that matrilysin confers macrophages with their most potent matrix metalloproteinase-dependent elastolytic system.
12958188 src oncogene signaling involves synergistic cooperation between the AP-1 and LEF-1 transcription factors in activation of the matrilysin promoter in colon cancer cells.
12808021 MMP-7 is induced in human gastric epithelial cells infected with Helicobacter pylori; it has a role in epithelial cell migration
12759346 findings suggest that local pericellular production of hypochlorous acid by phagocytes is a physiological mechanism for governing matrix metalloproteinase-7 activity during inflammation
12759241 In alveolar-like epithelial cells, transfection of activated matrilysin resulted in shedding of E-cadherin and accelerated cell migration. In vivo, matrilysin co-localized with E-cadherin at the basolateral surfaces of migrating tracheal epithelium.
12684625 Increased expression of MMP-7 in high grade renal cell carcinoma might be associated with tumor invasion and metastasis
12579270 increased expression of matrix metalloproteinase-7 is associated with high grade transitional cell carcinoma of the urinary bladder may be associated with tumor invasion and metastasis
12464266 Cleavage of FasL by MMP-7 occurs at the leucine residues in sequence "ELAELR" within the region between the transmembrane and trimerization domains. When this site is unavailable, a "SL," is cleaved. MMP-7 differentially processes murine and human FasL
12112311 study of expression in ulcerative colitis related tumorigenesis
12034345 destruction of the surrounding matrix by endometriosis might be caused by various MMPs, which are mainly produced in stromal cells.
12005165 Immunoelectron microscopy revealed that matrix metalloproteinase-7 was expressed within basal laminar deposits and amorphous materials around the retinal pigment epithelial cells in age-related macular degeneration.
11983918 Gene expression analysis reveals matrilysin as a key regulator of pulmonary fibrosis in mice and humans.
11927011 Overexpression of MMP-7 is associated with invasiveness in gastric carcinoma
11925859 plays an important role not only in tumor metastasis but in micrometastasis to lymph node
11801551 MMP-7 activity is upregulated in colorectal cancer liver metastases
11701474 Observational study of gene-disease association. (HuGE Navigator)
11220743 HIV-1 gp120-treated vaginal epithelial cells show upregulation of matrix metallopeptidase 7 (MMP7) expression as compared to untreated control

AA Sequence

MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPI      1 - 70
TGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEI     71 - 140
PLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLY    141 - 210
AATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK                 211 - 267
//

Text Mined References (371)

PMID Year Title
27078876 2016 Sphingomyelinase D from Loxosceles laeta Venom Induces the Expression of MMP7 in Human Keratinocytes: Contribution to Dermonecrosis.
27069188 2016 Searching for New Biomarkers and the Use of Multivariate Analysis in Gastric Cancer Diagnostics.
26906940 2016 Elevated Urinary Matrix Metalloproteinase-7 Detects Underlying Renal Allograft Inflammation and Injury.
26792722 2016 Rab11-FIP2 promotes colorectal cancer migration and invasion by regulating PI3K/AKT/MMP7 signaling pathway.
26652716 2015 MMP2 and MMP7 at the invasive front of gastric cancer are not associated with mTOR expression.
26648518 2016 Tanshinone IIA decreases the migratory ability of AGS cells by decreasing the protein expression of matrix metalloproteinases, nuclear factor ?B-p65 and cyclooxygenase-2.
26520416 2016 MMP-7 is a highly specific negative marker for benign and malignant mesothelial cells in serous effusions.
26507660 2016 Protein Kinase D2 Assembles a Multiprotein Complex at the Trans-Golgi Network to Regulate Matrix Metalloproteinase Secretion.
26464654 2015 Expression and correlation of matrix metalloproteinase-7 and interleukin-15 in human osteoarthritis.
26457789 2015 Pro-nerve growth factor in the ovary and human granulosa cells.
26418251 2015 Astrocyte elevated gene-1 increases invasiveness of NSCLC through up-regulating MMP7.
26412030 Urine matrix metalloproteinase-7 and risk of kidney disease progression and mortality in type 2 diabetes.
26408312 2015 Evaluation of the correlation of KAI1/CD82, CD44, MMP7 and ?-catenin in the prediction of prognosis and metastasis in colorectal carcinoma.
26402225 2015 Placental growth factor promotes metastases of ovarian cancer through MiR-543-regulated MMP7.
26330178 2015 Associations of MMP-7 and OPN gene polymorphisms with risk of coal workers' pneumoconiosis in a Chinese population: a case-control study.
26301605 2015 MMP1, 2, 3, 7, and 9 gene polymorphisms and urinary cancer risk: a meta-analysis.
26229436 2015 Clinicopathological significance of matrix metalloproteinase-7 protein expression in esophageal cancer: a meta-analysis.
26214021 2015 5-hydroxytryptamine receptor (5-HT1DR) promotes colorectal cancer metastasis by regulating Axin1/?-catenin/MMP-7 signaling pathway.
26164539 2015 Levels of circulating MMP-7 degraded elastin are elevated in pulmonary disorders.
26116564 2015 NOX1 to NOX2 switch deactivates AMPK and induces invasive phenotype in colon cancer cells through overexpression of MMP-7.
25919283 2014 Prognostic significance of matrix metalloproteinase-7 in gastric cancer survival: a meta-analysis.
25901368 2015 Targets of Wnt/ß-catenin transcription in penile carcinoma.
25875355 2015 MMP7 is required to mediate cell invasion and tumor formation upon Plakophilin3 loss.
25847246 2015 Association of MMP7 -181A?G Promoter Polymorphism with Gastric Cancer Risk: INFLUENCE OF NICOTINE IN DIFFERENTIAL ALLELE-SPECIFIC TRANSCRIPTION VIA INCREASED PHOSPHORYLATION OF cAMP-RESPONSE ELEMENT-BINDING PROTEIN (CREB).
25823818 2015 By activating matrix metalloproteinase-7, shear stress promotes chondrosarcoma cell motility, invasion and lung colonization.
25770908 Matrix remodeling by MMPs during wound repair.
25676403 2015 [EFEMP1 suppresses growth and invasion of lung cancer cells ?by downregulating matrix metalloproteinase-7 expression].
25607396 2014 Matrix metalloproteinase -7, -8, -9 and -13 in gingival tissue of patients with type 1 diabetes and periodontitis.
25588786 2015 Elevated matrix metalloproteinase-7 expression promotes metastasis in human lung carcinoma.
25579141 2014 Association of matrix metalloproteinase-7 (-181A/G) promoter polymorphism in chronic pancreatitis.
25549795 2015 The matrix metalloproteinase-7 and pro-enzyme of metalloproteinase-1 as a potential marker for patients with rectal cancer without distant metastasis.
25368272 2014 Measurement of serum carcinoembryonic antigen, carbohydrate antigen 19-9, cytokeratin-19 fragment and matrix metalloproteinase-7 for detecting cholangiocarcinoma: a preliminary case-control study.
25357219 2014 Observation of microvessels and invasion in early colorectal neoplasms on narrow band imaging: combination with CD34 and matrix metalloproteinase-7 expression.
25338725 2015 Overexpression of Reg4, alone or combined with MMP-7 overexpression, is predictive of poor prognosis in colorectal cancer.
25330950 2015 Nrdp1 inhibits metastasis of colorectal cancer cells by EGFR signaling-dependent MMP7 modulation.
25321193 2014 Shed Syndecan-1 is involved in chemotherapy resistance via the EGFR pathway in colorectal cancer.
25300296 2014 Overexpression of matrix metalloproteinases in lung tissue of patients with primary spontaneous pneumothorax.
25263962 2014 Simulated physiological stretch-induced proliferation of human bladder smooth muscle cells is regulated by MMPs.
25123263 2014 Matrix metalloproteinase-7 mRNA and protein expression in gastric carcinoma: a meta-analysis.
25091573 2014 Inhibition of fibroblast growth factor receptor signaling impairs metastasis of hepatocellular carcinoma.
25063248 2015 Matrix metalloproteinase-7 A-181G and its interaction with matrix metalloproteinase-9 C-1562T polymorphism in preeclamptic patients: association with malondialdehyde level and severe preeclampsia.
25008564 2014 Epidermal growth factor induces FoxO1 nuclear exclusion to activate MMP7-mediated metastasis of larynx carcinoma.
24981249 2014 MiRNA-34a inhibits EGFR-signaling-dependent MMP7 activation in gastric cancer.
24980707 2014 FEV1 inversely correlates with metalloproteinases 1, 7, 9 and CRP in COPD by biomass smoke exposure.
24930385 2014 Expression and activity levels of matrix metalloproteinase-7 and in situ localization of caseinolytic activity in colorectal cancer.
24903600 2014 Pericellular proteolysis by matrix metalloproteinase-7 is differentially modulated by cholesterol sulfate, sulfatide, and cardiolipin.
24847890 2014 Hypomethylation of the MMP7 promoter and increased expression of MMP7 distinguishes the basal-like breast cancer subtype from other triple-negative tumors.
24833109 2014 Matrilysin/matrix metalloproteinase-7(MMP7) cleavage of perlecan/HSPG2 creates a molecular switch to alter prostate cancer cell behavior.
24755685 2014 The diagnostic importance of matrix metalloproteinase-7 and nestin in gastrointestinal stromal tumors.
24704993 2014 MMP-7 is upregulated by COX-2 and promotes proliferation and invasion of lung adenocarcinoma cells.
24632608 2015 MMP7-mediated cleavage of nucleolin at Asp255 induces MMP9 expression to promote tumor malignancy.
24624896 2014 Matrilysin (MMP-7) catalytic activity regulates ?-catenin localization and signaling activation in lung epithelial cells.
24615104 2014 Association of MMP7-181A/G and MMP13-77A/G polymorphisms with colorectal cancer in a Mexican population.
24613844 2014 Interleukin-1? promotes extracellular shedding of syndecan-2 via induction of matrix metalloproteinase-7 expression.
24469951 2014 Matrix metalloproteinase 7 is a useful marker for 5-fluorouracil-based adjuvant chemotherapy in stage II and stage III colorectal cancer patients.
24425843 MMP7 expression in colorectal tumours of different stages.
24400123 2014 Matrix metalloproteinase 7 is associated with symptomatic lesions and adverse events in patients with carotid atherosclerosis.
24283384 2014 MicroRNA-148a is downregulated in gastric cancer, targets MMP7, and indicates tumor invasiveness and poor prognosis.
24270662 2014 Gene expression profiling of the leading edge of cutaneous squamous cell carcinoma: IL-24-driven MMP-7.
24261884 2013 Glutamate acid decarboxylase 1 promotes metastasis of human oral cancer by ?-catenin translocation and MMP7 activation.
24143235 2013 Differential activation of Wnt-?-catenin pathway in triple negative breast cancer increases MMP7 in a PTEN dependent manner.
24048760 2014 Clinicopathological significance of MMP-7, laminin ?2 and EGFR expression at the invasive front of gastric carcinoma.
24043512 2013 Association of genotypes at the matrix metalloproteinase (MMP) loci with carotid IMT and presence of carotid and femoral atherosclerotic plaques.
23953525 Identification of the effects of aging-related gene-matrix metalloproteinase on allograft outcomes in kidney transplantation.
23895900 2013 Matrix metalloproteinase7 -181A/G polymorphism is associated with increased cancer risk among high-quality studies: Evidence from a meta-analysis.
23893803 2013 Genetic polymorphisms in Matrix Metalloproteinases -1 and -7 and susceptibility to gastric cancer: an association study and meta-analysis.
23807291 2013 An ex vivo study on immunohistochemical localization of MMP-7 and MMP-9 in temporomandibular joint discs with internal derangement.
23803888 2013 ?,?-carotene 15,15'-monooxygenase and its substrate ?-carotene modulate migration and invasion in colorectal carcinoma cells.
23790336 2013 COX-2, MMP-7 expression in oral lichen planus and oral squamous cell carcinoma.
23783374 2013 Expression of cilium-associated genes defines novel molecular subtypes of idiopathic pulmonary fibrosis.
23725125 2013 Current evidence on associations between the MMP-7 (-181A>G) polymorphism and digestive system cancer risk.
23682078 2013 Identification of putative immunologic targets for colon cancer prevention based on conserved gene upregulation from preinvasive to malignant lesions.
23671562 2013 Chronic IL9 and IL-13 exposure leads to an altered differentiation of ciliated cells in a well-differentiated paediatric bronchial epithelial cell model.
23644699 2013 Association between promoters polymorphisms of matrix metalloproteinases and risk of digestive cancers: a meta-analysis.
23562717 2013 Update meta-analysis on MMP-7 -181A>G polymorphism and cancer risk: evidence from 25 studies.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23437250 2013 miR-126&126* restored expressions play a tumor suppressor role by directly regulating ADAM9 and MMP7 in melanoma.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23344661 2013 Integrins ?4 and ?M, collagen1A1, and matrix metalloproteinase 7 are upregulated in acute Kawasaki disease vasculopathy.
23343931 2013 MMP expression in rheumatoid inflammation: the rs11568818 polymorphism is associated with MMP-7 expression at an extra-articular site.
23300791 2012 Achaete-scute complex homolog-1 promotes DNA repair in the lung carcinogenesis through matrix metalloproteinase-7 and O(6)-methylguanine-DNA methyltransferase.
23249718 2012 [The expression level and clinical significance of MMP-7 protein in peripheral blood in the patients with lung cancer].
23076342 2013 ETS variant 1 regulates matrix metalloproteinase-7 transcription in LNCaP prostate cancer cells.
23065739 2012 Serum CA19-9, cathepsin D, and matrix metalloproteinase-7 as a diagnostic panel for pancreatic ductal adenocarcinoma.
22974215 2012 MMP7 is a target of the tumour-associated antigen EpCAM.
22957785 2012 REG4 contributes to the invasiveness of pancreatic cancer by upregulating MMP-7 and MMP-9.
22957090 2012 Secreted protein acidic and rich in cysteine (SPARC) suppresses angiogenesis by down-regulating the expression of VEGF and MMP-7 in gastric cancer.
22944341 Clinical significance of MMP-7 and PTEN expression in colorectal cancer.
22936257 2012 Expression of metalloproteinases 1, 2, 7, 9, and 12 in human cytotrophoblastic cells from normal and preeclamptic placentas.
22883281 2012 Matrix metalloproteinase-7 and matrix metalloproteinase-9 in pediatric multiple sclerosis.
22645431 2012 Expressions of MMPs and TIMP-1 in gastric ulcers may differentiate H. pylori-infected from NSAID-related ulcers.
22645147 2012 The forkhead box transcription factor FOXC1 promotes breast cancer invasion by inducing matrix metalloprotease 7 (MMP7) expression.
22631636 2012 Expression and prognostic value of matrix metalloproteinase-7 in colorectal cancer.
22621753 2012 Higher risk of matrix metalloproteinase (MMP-2, 7, 9) and tissue inhibitor of metalloproteinase (TIMP-2) genetic variants to gallbladder cancer.
22582975 2012 The influence of transforming growth factor-?, cyclooxygenase-2, matrix metalloproteinase (MMP)-7, MMP-9 and CXCR4 proteins involved in epithelial-mesenchymal transition on overall survival of patients with gastric cancer.
22524815 2012 Application of MMP-7 and MMP-10 in assisting the diagnosis of malignant pleural effusion.
22417142 2012 Is MMP-7 gene polymorphism a possible risk factor for chronic obstructive pulmonary disease in Turkish patients.
22368250 2012 A possibility of a protein-bound water molecule as the ionizable group responsible for pKe at the alkaline side in human matrix metalloproteinase 7 activity.
22292085 2012 The transcription factor SOX18 regulates the expression of matrix metalloproteinase 7 and guidance molecules in human endothelial cells.
22268124 2012 Allele-specific transactivation of matrix metalloproteinase 7 by FOXA2 and correlation with plasma levels in idiopathic pulmonary fibrosis.
22246095 2011 A/G Polymorphism of the MMP-7 Gene Promoter Region in Colorectal Cancer.
22227189 2012 The matrix metalloproteinase-7 regulates the extracellular shedding of syndecan-2 from colon cancer cells.
22215634 2012 Matrilysin (MMP-7) inhibition of BMP-7 induced renal tubular branching morphogenesis suggests a role in the pathogenesis of human renal dysplasia.
22200690 2012 Expression of MMP-2, -7, -9, MT1-MMP and TIMP-1 and -2 has no prognostic relevance in patients with advanced epithelial ovarian cancer.
22131018 2012 Phosphatase of regenerating liver-3 promotes migration and invasion by upregulating matrix metalloproteinases-7 in human colorectal cancer cells.
22113040 2011 [Study on association between single nucleotide polymorphisms of MMP7, MMP8, MMP9 genes and development of gastric cancer and lymph node metastasis].
22095947 2012 Matrix metalloproteinase-7 as a surrogate marker predicts renal Wnt/?-catenin activity in CKD.
22089237 2011 Constitutive coupling of a naturally occurring human alpha1a-adrenergic receptor genetic variant to EGFR transactivation pathway.
22076613 2012 Tissue factor/activated factor VIIa induces matrix metalloproteinase-7 expression through activation of c-Fos via ERK1/2 and p38 MAPK signaling pathways in human colon cancer cell.
22051851 2012 Temporal investigation of matrix metalloproteinases and their inhibitors in human cervicovaginal fluid in late pregnancy and labor.
22047080 2012 MMP7 -181G allele is a low-penetrant risk factor for cancer development in East Asians.
22042554 2012 Down-regulation of matrix metalloproteinase-7 inhibits metastasis of human anaplastic thyroid cancer cell line.
22024063 Immunohistochemical study of vascular endothelial growth factor (VEGF) and matrilysin (MMP-7) in T1 adenocarcinoma of the colon and rectum to predict lymph node metastases or distant metastases.
21999204 2012 Mesothelin enhances invasion of ovarian cancer by inducing MMP-7 through MAPK/ERK and JNK pathways.
21981819 2011 Antisense oligonucleotide targeting matrix metalloproteinase-7 (MMP-7) changes the ultrastructure of human A549 lung adenocarcinoma cells.
21935919 2012 Plasma hydroxyproline, MMP-7 and collagen I as novel predictive risk markers of hepatobiliary disease-associated cholangiocarcinoma.
21912055 Association of matrix metalloproteinase-7 (-181A>G) polymorphism with risk of esophageal squamous cell carcinoma in Kashmir Valley.
21901248 2012 Fibulin-3 promoter methylation alters the invasive behavior of non-small cell lung cancer cell lines via MMP-7 and MMP-2 regulation.
21858178 2011 Ectopic pregnancy as a model to identify endometrial genes and signaling pathways important in decidualization and regulated by local trophoblast.
21814482 2011 Dimerumic acid inhibits SW620 cell invasion by attenuating H?O?-mediated MMP-7 expression via JNK/C-Jun and ERK/C-Fos activation in an AP-1-dependent manner.
21787888 2011 Thermodynamic analysis of ionizable groups involved in the catalytic mechanism of human matrix metalloproteinase 7 (MMP-7).
21764478 2012 Overexpression of matrix metalloproteinase-7 and -9 in NSCLC tumor and stromal cells: correlation with a favorable clinical outcome.
21722074 2011 Association of a functional polymorphism in the MMP7 gene promoter with susceptibility to vulnerable carotid plaque in a Han Chinese population.
21707759 2011 Elevated MMP-7 levels in patients with systemic sclerosis: correlation with pulmonary involvement.
21593056 2011 Tyr219 of human matrix metalloproteinase 7 is not critical for catalytic activity, but is involved in the broad pH-dependence of the activity.
21517234 2011 Role of the metalloproteinase-7 (181A>G) polymorphism in gastric cancer susceptibility: a case control study in Kashmir valley.
21516345 2011 Matrix metalloproteinases and soluble Fas/FasL system as novel regulators of apoptosis in children and young adults on chronic dialysis.
21481787 2011 Stat3 and MMP7 contribute to pancreatic ductal adenocarcinoma initiation and progression.
21455340 2011 Autoantibodies against MMP-7 as a novel diagnostic biomarker in esophageal squamous cell carcinoma.
21336735 2011 Correlation of polymorphism of IL-8 and MMP-7 with occurrence and lymph node metastasis of early stage cervical cancer.
21315773 2011 Human T-cell leukemia virus type 1 tax transactivates the matrix metalloproteinase 7 gene via JunD/AP-1 signaling.
21302026 2011 Marked relationship between matrix metalloproteinase 7 and brain atrophy in HIV infection.
21255765 2011 Immunohistochemical expression of matrix metalloproteinases in squamous cell carcinoma of the tongue and lower lip.
21165404 2010 Matrix metalloproteinases 2, 7, and 9 and tissue inhibitor of metalloproteinases-1 in tumors and serum of patients with ovarian neoplasms.
21116502 2009 Comparative enzyme immunoassay of matrix metalloproteinases-2, -7, -9 and their tissue inhibitor-2 in tumors and plasma of patients with gastric cancer.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20979817 2010 [Change of matrix metalloproteinase-1 and matrix metalloproteinase-7 in serum and bronchoalveolar lavage fluid of patients with idiopathic pulmonary fibrosis and sarcoidosis].
20939893 2010 Catecholamine up-regulates MMP-7 expression by activating AP-1 and STAT3 in gastric cancer.
20872971 2010 Prospective study of MMP7 serum levels in the diagnosis of cholangiocarcinoma.
20853162 2011 Neutrophil gelatinase-associated lipocalin (NGAL) and matrix metalloproteinases as novel stress markers in children and young adults on chronic dialysis.
20827277 2010 Matrix metalloproteinase haplotypes associated with coronary artery aneurysm formation in patients with Kawasaki disease.
20826916 2010 Bladder cancer risk associated with genotypic polymorphism of the matrix metalloproteinase-1 and 7 in North Indian population.
20813660 2010 [Protein kinase D3 is involved in negative regulation of MMP-7 in prostate cancer cells].
20736794 2010 Matrix metalloproteinases that associate with and cleave bone morphogenetic protein-2 in vitro are elevated in hypertrophic fracture nonunion tissue.
20730428 2010 Clinical impact of MMP and TIMP gene polymorphisms in gastric cancer.
20707923 2010 Matrix metalloproteinase-3 promoter polymorphisms but not dupA-H. pylori correlate to duodenal ulcers in H. pylori-infected females.
20680712 2010 Prognostic impact of ER? and MMP7 expression on overall survival in colon cancer.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20662554 2010 Association of matrix metalloproteinases 1, 7, and 9 gene polymorphisms with genetic susceptibility to colorectal carcinoma in a Han Chinese population.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20624652 2010 IL-13 and TH2 cytokine exposure triggers matrix metalloproteinase 7-mediated Fas ligand cleavage from bronchial epithelial cells.
20605794 2010 Cholesterol sulfate alters substrate preference of matrix metalloproteinase-7 and promotes degradations of pericellular laminin-332 and fibronectin.
20605361 2011 The matrix metalloproteinase-7 polymorphism rs10895304 is associated with increased recurrence risk in patients with clinically localized prostate cancer.
20587546 2010 Interferon gamma receptor 2 gene variants are associated with liver fibrosis in patients with chronic hepatitis C infection.
20584750 2010 Nitric oxide-mediated invasion in Barrett's high-grade dysplasia and adenocarcinoma.
20491537 2010 Matrilysins may not predict the metastatic potential in squamous cell carcinoma of the tongue.
20484597 2010 Association of matrix metalloproteinase gene polymorphisms with refractive error in Amish and Ashkenazi families.
20473942 2011 Elevated serum matrix metalloproteinase 7 levels predict poor prognosis after radical prostatectomy.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20375326 2010 Pathway-focused arrays reveal increased matrix metalloproteinase-7 (matrilysin) transcription in trachomatous trichiasis.
20372795 2010 MMP-7 and SGCE as distinctive molecular factors in sporadic colorectal cancers from the mutator phenotype pathway.
20360147 2010 Meta-analysis of association between matrix metalloproteinases 2, 7 and 9 promoter polymorphisms and cancer risk.
20359117 2009 [Expression and clinical significance of Ang-2 and MMP-7 in laryngeal carcinoma].
20347338 2010 Genetic polymorphisms in MMP7 and reduced serum levels associate with the development of bronchiolitis obliterans syndrome after lung transplantation.
20300917 2010 MMP-7 overexpression is an independent prognostic marker in gastric cancer.
20230842 2010 Association between polymorphisms of matrix metalloproteinase 11 (MMP-11) and Kawasaki disease in the Korean population.
20219015 2011 Type-specific dysregulation of matrix metalloproteinases and their tissue inhibitors in end-stage heart failure patients: relationship between MMP-10 and LV remodelling.
20192597 2009 Influence of matrix metalloproteinase gene polymorphisms in healthy North Indians compared to variations in other ethnic groups worldwide.
20180812 2010 Matrix metalloproteinase-7 as a marker of metastasis and predictor of poor survival in bladder cancer.
20156184 2010 Production of active MMP7 in E. coli and its application for metalloproteinase inhibitors screening.
20146992 2010 Influence of significant weight loss on serum matrix metalloproteinase (MMP)-7 levels.
20139113 2010 MMP-7 mediates cleavage of N-cadherin and promotes smooth muscle cell apoptosis.
20132413 2011 Gene expression signatures differentiate ovarian/peritoneal serous carcinoma from breast carcinoma in effusions.
20113256 2010 Matrix metalloproteinase-7 (MMP-7) polymorphism is a risk factor for endometrial cancer susceptibility.
20096949 2010 Serum MMP-7 is increased in diabetic renal disease and diabetic diastolic dysfunction.
20040080 2009 Plexin-B1, glycodelin and MMP7 expression in the human fallopian tube and in the endometrium.
20007614 2010 Analysis of matrix metalloproteinase-7 expression in eutopic and ectopic endometrium samples from patients with different forms of endometriosis.
19929564 2010 Matrix metalloproteinase (MMP)-7 in salivary gland cancer.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19787626 Metalloproteinase-1, metalloproteinase-7, and p53 immunoexpression and their correlation with clinicopathological prognostic factors in colorectal adenocarcinoma.
19785773 2009 MMP7 expression regulated by endocrine therapy in ERbeta-positive colon cancer cells.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19728912 2009 [Expression and clinical significance of survivin and matrix metalloproteinase-7 in colon cancer].
19724852 2009 CD44v6, MMP-7 and nuclear Cdx2 are significant biomarkers for prediction of lymph node metastasis in primary gastric cancer.
19701966 2009 Overexpression of beta3/gamma2 chains of laminin-5 and MMP7 in biliary cancer.
19690958 2010 Elevated serum matrix metalloproteinase-3 and -7 in H. pylori-related gastric cancer can be biomarkers correlating with a poor survival.
19690403 2010 Small airway remodeling in idiopathic interstitial pneumonias: a pathological study.
19682489 2009 Cellular senescence of human mammary epithelial cells (HMEC) is associated with an altered MMP-7/HB-EGF signaling and increased formation of elastin-like structures.
19679556 2009 Osteoclast-derived matrix metalloproteinase-7, but not matrix metalloproteinase-9, contributes to tumor-induced osteolysis.
19676133 2009 A novel nonsynonymous variant of matrix metalloproteinase-7 confers risk of liver cirrhosis.
19654318 2009 Control of promatrilysin (MMP7) activation and substrate-specific activity by sulfated glycosaminoglycans.
19643940 2010 Single nucleotide polymorphisms in matrix metalloproteinase genes and lung cancer chemotherapy response and prognosis.
19634113 E-cadherin and metalloproteinase-1 and -7 polymorphisms in colorectal cancer.
19608871 2009 Matrilysin-1 mediates bronchiolization of alveoli, a potential premalignant change in lung cancer.
19596921 2009 Expression of MMP-7, MMP-9, TIMP-1 and TIMP-2 mRNA in lung tissue of patients with non-small cell lung cancer (NSCLC) and benign pulmonary disease.
19586554 2009 Downregulation of SFRP5 expression and its inverse correlation with those of MMP-7 and MT1-MMP in gastric cancer.
19505922 2009 Fecal cyclooxygenase 2 plus matrix metalloproteinase 7 mRNA assays as a marker for colorectal cancer screening.
19465902 2009 Distinction of hepatocellular adenoma from hepatocellular carcinoma with and without cirrhosis using E-cadherin and matrix metalloproteinase immunohistochemistry.
19435861 2009 No association between matrix metalloproteinase (MMP)-1, MMP-3, and MMP-7 SNPs and endometrial cancer risk.
19421758 2009 Elevated expressions of MMP7, TROP2, and survivin are associated with survival, disease recurrence, and liver metastasis of colon cancer.
19420105 2009 A candidate gene approach to genetic prognostic factors of IgA nephropathy--a result of Polymorphism REsearch to DIstinguish genetic factors Contributing To progression of IgA Nephropathy (PREDICT-IgAN).
19360357 2009 Three-dimensional culture using a radial flow bioreactor induces matrix metalloprotease 7-mediated EMT-like process in tumor cells via TGFbeta1/Smad pathway.
19329997 2009 Divergent functions for airway epithelial matrix metalloproteinase 7 and retinoic acid in experimental asthma.
19317620 2009 Transforming growth factor-B1 and matrix metalloproteinase-7 promoter variants induce risk for Helicobacter pylori-associated gastric precancerous lesions.
19303106 2009 Genetic polymorphisms of matrix metalloproteinases: susceptibility and prognostic implications for prostate cancer.
19266094 2009 The role of MMP7 and its cross-talk with the FAS/FASL system during the acquisition of chemoresistance to oxaliplatin.
19231585 2009 Inhibition of hyaluronan synthases decreases matrix metalloproteinase-7 (MMP-7) expression and activity.
19221016 2009 Acetylcholine-induced activation of M3 muscarinic receptors stimulates robust matrix metalloproteinase gene expression in human colon cancer cells.
19181662 2009 Differential Processing of {alpha}- and {beta}-Defensin Precursors by Matrix Metalloproteinase-7 (MMP-7).
19173304 2009 Matrilysin (MMP-7) cleaves C-type lectin domain family 3 member A (CLEC3A) on tumor cell surface and modulates its cell adhesion activity.
19132754 2009 Putative functional polymorphisms of MMP9 predict survival of NSCLC in a Chinese population.
19121849 2009 Phosphorylated hepatocyte growth factor receptor/c-Met is associated with tumor growth and prognosis in patients with bladder cancer: correlation with matrix metalloproteinase-2 and -7 and E-cadherin.
19094228 2008 The influence of genetic variation in 30 selected genes on the clinical characteristics of early onset breast cancer.
19022775 2009 RECK forms cowbell-shaped dimers and inhibits matrix metalloproteinase-catalyzed cleavage of fibronectin.
19020757 2008 Serous and mucinous ovarian tumors express different profiles of MMP-2, -7, -9, MT1-MMP, and TIMP-1 and -2.
19016757 2008 Detection of colorectal cancer cells from feces using quantitative real-time RT-PCR for colorectal cancer diagnosis.
19000448 2008 [Effects of tamoxifen on apoptosis and matrix metalloproteinase-7 expression in estrogen receptor beta-positive colonic cancer cell line HT-29].
18974372 2009 Degradation of soluble VEGF receptor-1 by MMP-7 allows VEGF access to endothelial cells.
18958543 2008 Polymorphisms of matrix metalloproteinase-7 and chymase are associated with susceptibility to and progression of gastric cancer in Japan.
18955490 2008 Identification of amino acid residues of matrix metalloproteinase-7 essential for binding to cholesterol sulfate.
18931651 2008 Active matrix metalloproteinase-7 is associated with invasion in buccal squamous cell carcinoma.
18823373 2008 Predictive value of MMP-7 expression for response to chemotherapy and survival in patients with non-small cell lung cancer.
18805052 2008 Characterization of the paracrine effects of human skeletal myoblasts transplanted in infarcted myocardium.
18798254 2009 Genetic polymorphisms in the MMP-7 gene and breast cancer survival.
18768525 2008 No association of MMP-7, MMP-8, and MMP-21 polymorphisms with the risk of hepatocellular carcinoma in a Chinese population.
18721140 2008 Matrilysin (matrix metalloprotease-7) cleaves membrane-bound annexin II and enhances binding of tissue-type plasminogen activator to cancer cell surfaces.
18715618 2008 Correlation between beta-catenin widespread nuclear expression and matrix metalloproteinase-7 overexpression in sporadic desmoid tumors.
18713744 2008 Ephrin-B2-induced cleavage of EphB2 receptor is mediated by matrix metalloproteinases to trigger cell repulsion.
18695873 2008 Activin A enhances MMP-7 activity via the transcription factor AP-1 in an esophageal squamous cell carcinoma cell line.
18674869 2008 E-cadherin, beta-catenin adhesion complex and relation to matrilysin expression in pT3 rectosigmoid cancers.
18653469 2008 p120 and Kaiso regulate Helicobacter pylori-induced expression of matrix metalloproteinase-7.
18648013 2008 Common MMP-7 polymorphisms and breast cancer susceptibility: a multistage study of association and functionality.
18644839 2008 MMP-7 cleaves the NR1 NMDA receptor subunit and modifies NMDA receptor function.
18636198 2008 Clinicopathological significance of the gene expression of matrix metalloproteinase-7, insulin-like growth factor-1, insulin-like growth factor-2 and insulin-like growth factor-1 receptor in patients with colorectal cancer: insulin-like growth factor-1 receptor gene expression is a useful predictor of liver metastasis from colorectal cancer.
18600430 2008 Heregulin-beta promotes matrix metalloproteinase-7 expression via HER2-mediated AP-1 activation in MCF-7 cells.
18548257 2008 The FVIIa-tissue factor complex induces the expression of MMP7 in LOVO cells in vitro.
18511876 2007 Association of E1AF mRNA expression with tumor progression and matrilysin in human rectal cancer.
18500535 2008 Expression and intracellular localization of matrix metalloproteinases in intraductal papillary mucinous neoplasms of the pancreas.
18485588 2008 Human leukocyte elastase counteracts matrix metalloproteinase-7 induced apoptosis resistance of tumor cells.
18448157 2008 MMP-7 (-181A>G) promoter polymorphisms and risk for cervical cancer.
18447576 2008 MMP1 and MMP7 as potential peripheral blood biomarkers in idiopathic pulmonary fibrosis.
18422740 2008 Plasma matrix metalloproteinase-7 as a metastatic marker and survival predictor in patients with renal cell carcinomas.
18411043 2008 HER2-dependent MMP-7 expression is mediated by activated STAT3.
18385523 2008 Tissue inhibitor of metalloproteinase-1 moderates airway re-epithelialization by regulating matrilysin activity.
18364512 2008 Matrix metalloproteinase-7 and the 20S proteasome contribute to cellular senescence.
18340552 2008 Matrilysin inhibits proliferation and modulates sensitivity of lung cancer cells to FasL-mediated apoptosis.
18329694 2008 Expression of matrix metalloproteinase 7 is an unfavorable postoperative prognostic factor in cholangiocarcinoma of the perihilar, hilar, and extrahepatic bile ducts.
18308831 2008 Genetic polymorphisms of matrix metalloproteinase 12 and 13 genes are implicated in endometriosis progression.
18214300 2007 Matrix metalloproteinases 7 and 9 and their types 1 and 4 tissue inhibitors in tumors and plasma of patients with colorectal cancer.
18202161 2008 Identification of pro-MMP-7 as a serum marker for renal cell carcinoma by use of proteomic analysis.
18179407 2008 Significant increase in the expression of matrix metalloproteinase 7 in primary CNS lymphoma.
18036564 2007 Intrinsic selectivity in binding of matrix metalloproteinase-7 to differently charged lipid membranes.
18023162 2008 Endothelium specific matrilysin (MMP-7) expression in human cancers.
18006768 2007 Matrix metalloproteinase single-nucleotide polymorphisms and haplotypes predict breast cancer progression.
17728005 2007 Overexpression of matrix metalloproteinase-7 (MMP-7) correlates with tumor proliferation, and a poor prognosis in non-small cell lung cancer.
17718429 2007 [Expression and clinical significance of matrilysin (MMP-7) in human rectal cancer].
17695544 High gene expression of matrix metalloproteinase-7 is associated with early stages of oral cancer.
17672933 2007 [Correlations of polymorphisms in matrix metalloproteinase-3 and -7 promoters to susceptibility to brain astrocytoma].
17671679 2007 Vascular endothelial growth factor, matrix metalloproteinases, and cyclooxygenase-2 influence prognosis of uterine cervical cancer in young women.
17607721 2007 Functional polymorphisms and haplotypes in the promoter of the MMP2 gene are associated with risk of nasopharyngeal carcinoma.
17564313 2004 Expression of matrix metalloproiteinases (MMPs) and tissue inhibitors of metalloproteinases (TIMPs) in hepatocellular carcinoma tissue, compared with the surrounding non-tumor tissue.
17554258 2007 Advanced glycation end products decrease mesangial cell MMP-7: a role in matrix accumulation in diabetic nephropathy?
17507989 2007 Achaete-scute homolog-1 linked to remodeling and preneoplasia of pulmonary epithelium.
17502620 2007 Photodynamic molecular beacon as an activatable photosensitizer based on protease-controlled singlet oxygen quenching and activation.
17487834 2007 Serum matrix metalloproteinase 7 levels identifies poor prognosis advanced colorectal cancer patients.
17396032 2007 Association of extracellular cleavage of E-cadherin mediated by MMP-7 with HGF-induced in vitro invasion in human stomach cancer cells.
17373931 2007 Variation in the matrix metalloproteinase-3, -7, -12 and -13 genes is associated with functional status in rheumatoid arthritis.
17310281 2007 Binding of matrilysin-1 to human epithelial cells promotes its activity.
17219436 2007 MMP-7 (matrilysin) expression in human brain tumors.
17209789 2006 Gingival crevicular fluid matrix metalloproteinase (MMP)-7, extracellular MMP inducer, and tissue inhibitor of MMP-1 levels in periodontal disease.
17181997 2007 The effect of epidermal growth factor on matrix metalloproteinases and tissue inhibitors of metalloproteinase gene expression in cultured human gingival fibroblasts.
17153464 Expression of MMP-7 and MT1-MMP in peritoneal dissemination of gastric cancer.
17145868 2006 Matrilysin 1 influences colon carcinoma cell migration by cleavage of the laminin-5 beta3 chain.
17145820 2006 Expression of matrix metalloproteinase-7 on cancer cells and tissue endothelial cells in renal cell carcinoma: prognostic implications and clinical significance for invasion and metastasis.
17129995 Human disc degeneration is associated with increased MMP 7 expression.
17125518 2006 Genetic polymorphisms of MMP1, MMP3 and MMP7 gene promoter and risk of colorectal adenoma.
17114341 2006 Inhibition of matrilysin expression by antisense or RNA interference decreases lysophosphatidic acid-induced epithelial ovarian cancer invasion.
17038551 2007 Estrogen decrease in tight junctional resistance involves matrix-metalloproteinase-7-mediated remodeling of occludin.
17029196 2006 [Analysis of differential expression genes related to different metastasis potential of adenoid cystic carcinoma using restriction fragments differential display PCR].
17009258 2006 Tetraspanin CD151 is expressed in osteoarthritic cartilage and is involved in pericellular activation of pro-matrix metalloproteinase 7 in osteoarthritic chondrocytes.
17009118 2006 Role of matrix metalloproteinase-7 in colorectal adenomas.
16956593 2006 Association between the functional polymorphism in the matrix metalloproteinase-7 promoter and susceptibility to adult astrocytoma.
16940985 2006 Clinical impact of MMP and TIMP gene polymorphisms in gastric cancer.
16804904 2006 Prognostic significance of matrix metalloproteinase-7 in epithelial ovarian cancer and its relation to beta-catenin expression.
16494848 2006 Regulation of matrilysin expression in endothelium by fibroblast growth factor-2.
16476739 2006 Binding of active matrilysin to cell surface cholesterol sulfate is essential for its membrane-associated proteolytic action and induction of homotypic cell adhesion.
16474379 2006 Association of E-cadherin, matrix metalloproteinases, and tissue inhibitors of metalloproteinases with the progression and metastasis of hepatocellular carcinoma.
16474169 2006 Matrix metalloproteinase-7 increases resistance to Fas-mediated apoptosis and is a poor prognostic factor of patients with colorectal carcinoma.
16455621 2006 Polymorphisms in the promoter regions of the matrix metalloproteinases-7, -9 and the risk of endometriosis and adenomyosis in China.
16405530 2006 Genetic variants in matrix metalloproteinase genes are associated with development of gastric ulcer in H. Pylori infection.
16356191 2006 Regulatory polymorphisms in extracellular matrix protease genes and susceptibility to rheumatoid arthritis: a case-control study.
16286510 2005 Growth factor-induced shedding of syndecan-1 confers glypican-1 dependence on mitogenic responses of cancer cells.
16278009 2006 Polymorphisms in the promoter regions of the matrix metalloproteinases-1, -3, -7, and -9 and the risk of epithelial ovarian cancer in China.
16248458 2005 [The protein expression difference of transforming growth factor beta1, matrix metalloproteinases 1,7,9 and tissue inhibitors of matrix metalloproteinases-1 between chronic rhinosinusitis, nasal polyps and normal mucosa tissues].
16142384 2005 Expression of matrix metalloproteinases and tissue inhibitors of metalloproteinase in uterine endometrial carcinoma and a correlation between expression of matrix metalloproteinase-7 and prognosis.
16115946 2005 Targeting matrilysin and its impact on tumor growth in vivo: the potential implications in breast cancer therapy.
16097959 2005 Specific matrix metalloproteinase expression in focal myositis: an immunopathological study.
15979995 2005 Presence of membrane and soluble forms of Fas ligand and of matrilysin (MMP-7) activity in normal and abnormal human semen.
15930031 2005 The functional polymorphism in the matrix metalloproteinase-7 promoter increases susceptibility to esophageal squamous cell carcinoma, gastric cardiac adenocarcinoma and non-small cell lung carcinoma.
15894268 2005 MMP-7 promotes prostate cancer-induced osteolysis via the solubilization of RANKL.
15866216 2005 Expression of matrix metalloprotease-2, -7 and -9 on human colon, liver and bile duct cell lines by enteric and gastric Helicobacter species.
15860507 2005 (-)-Epigallocatechin-3-gallate promotes pro-matrix metalloproteinase-7 production via activation of the JNK1/2 pathway in HT-29 human colorectal cancer cells.
15809719 2005 Involvement of matrix metalloproteinase-7 in invasion-metastasis through induction of cell dissociation in pancreatic cancer.
15800927 2005 E1A-F is overexpressed early in human colorectal neoplasia and associated with cyclooxygenase-2 and matrix metalloproteinase-7.
15725655 2005 Nobiletin, a citrus flavonoid, down-regulates matrix metalloproteinase-7 (matrilysin) expression in HT-29 human colorectal cancer cells.
15696117 2005 Matrilysin (MMP-7) is a major matrix metalloproteinase upregulated in biliary atresia-associated liver fibrosis.
15652345 2005 Proliferative effects of apical, but not basal, matrix metalloproteinase-7 activity in polarized MDCK cells.
15618645 2004 Inhibitory effects of alcohols on the activity of human matrix metalloproteinase 7 (matrilysin).
15523695 2005 Matrilysin (MMP-7) promotes invasion of ovarian cancer cells by activation of progelatinase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15375490 2004 Expression spectra of matrix metalloproteinases in metastatic non-small cell lung cancer.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15239678 2004 Matrilysin-1 (MMP-7) and MMP-19 are expressed by Paget's cells in extramammary Paget's disease.
15149334 2004 Matrilysin (MMP-7) expression in renal tubular damage: association with Wnt4.
15102692 2004 Comprehensive analysis of matrix metalloproteinase and tissue inhibitor expression in pancreatic cancer: increased expression of matrix metalloproteinase-7 predicts poor survival.
15040016 2004 Expression of heparanase gene, CD44v6, MMP-7 and nm23 protein and their relationship with the invasion and metastasis of gastric carcinomas.
14744783 2004 Matrix metalloproteinase-7 facilitates insulin-like growth factor bioavailability through its proteinase activity on insulin-like growth factor binding protein 3.
14516315 2003 Role of PTEN and MMP-7 expression in growth, invasion, metastasis and angiogenesis of gastric carcinoma.
12963695 2003 Matrilysin-dependent elastolysis by human macrophages.
12958188 2003 Synergistic cooperation between the AP-1 and LEF-1 transcription factors in activation of the matrilysin promoter by the src oncogene: implications in cellular invasion.
12808021 2003 Stimulation of MMP-7 (matrilysin) by Helicobacter pylori in human gastric epithelial cells: role in epithelial cell migration.
12759346 2003 Hypochlorous acid generated by myeloperoxidase modifies adjacent tryptophan and glycine residues in the catalytic domain of matrix metalloproteinase-7 (matrilysin): an oxidative mechanism for restraining proteolytic activity during inflammation.
12759241 2003 Matrilysin (matrix metalloproteinase-7) mediates E-cadherin ectodomain shedding in injured lung epithelium.
12684625 Expression of matrix metalloproteinases 7 and 2 in human renal cell carcinoma.
12579270 Expression of matrix metalloproteinases in human transitional cell carcinoma of the urinary bladder.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12464266 2002 Identification of novel matrix metalloproteinase-7 (matrilysin) cleavage sites in murine and human Fas ligand.
12117418 2002 Structural and functional characterization of tissue factor pathway inhibitor following degradation by matrix metalloproteinase-8.
12034400 2002 A role for matrix metalloproteinases and tumor host interaction in hepatocellular carcinomas.
12034345 2002 Expression of matrix metalloproteinases in ovarian endometriomas: immunohistochemical study and enzyme immunoassay.
11983918 2002 Gene expression analysis reveals matrilysin as a key regulator of pulmonary fibrosis in mice and humans.
11979071 2002 Anetoderma: an altered balance between metalloproteinases and tissue inhibitors of metalloproteinases.
11925859 2002 [Correlation between expression of MMP-7 in gastric submucosal invasive carcinoma and lymph node micrometastasis].
11841844 2002 Selective cleavage of human IgG by the matrix metalloproteinases, matrilysin and stromelysin.
11825873 2002 CD44 anchors the assembly of matrilysin/MMP-7 with heparin-binding epidermal growth factor precursor and ErbB4 and regulates female reproductive organ remodeling.
11729324 2001 Regulation of cell survival by secreted proneurotrophins.
11718469 2001 Fluorescence polarization assay and SDS-PAGE confirms matrilysin degrades fibronectin and collagen IV whereas gelatinase A degrades collagen IV but not fibronectin.
11701474 2001 Allele-specific regulation of matrix metalloproteinase-7 promoter activity is associated with coronary artery luminal dimensions among hypercholesterolemic patients.
11375993 2001 Osteopontin, a novel substrate for matrix metalloproteinase-3 (stromelysin-1) and matrix metalloproteinase-7 (matrilysin).
11326276 2001 Beta-catenin-sensitive isoforms of lymphoid enhancer factor-1 are selectively expressed in colon cancer.
11323016 2001 Matrix metalloproteinase deficiencies do not impair cell-associated fibrinolytic activity.
11320086 2001 The breast cancer beta 4 integrin and endothelial human CLCA2 mediate lung metastasis.
11247893 2001 Parallel expression of macrophage metalloelastase (MMP-12) in duodenal and skin lesions of patients with dermatitis herpetiformis.
11220743 2001 HIV-1 Tat neurotoxicity is prevented by matrix metalloproteinase inhibitors.
10986281 2000 Brevican is degraded by matrix metalloproteinases and aggrecanase-1 (ADAMTS4) at different sites.
10859319 2000 Matrix metalloproteinases cleave tissue factor pathway inhibitor. Effects on coagulation.
10504457 1999 Accumulation of matrilysin (MMP-7) and macrophage metalloelastase (MMP-12) in actinic damage.
10419448 1999 Matrix metalloproteinases.
9888422 1999 Immunolocalization and gene expression of matrilysin during corneal wound healing.
9737711 1998 Matrix metalloproteinases: structures, evolution, and diversification.
9548733 1998 Generation of an angiostatin-like fragment from plasminogen by stromelysin-1 (MMP-3).
9360944 1997 Angiostatin-converting enzyme activities of human matrilysin (MMP-7) and gelatinase B/type IV collagenase (MMP-9).
9349239 1997 Imbalance of expression of matrix metalloproteinases (MMPs) and tissue inhibitors of the matrix metalloproteinases (TIMPs) in human pancreatic carcinoma.
9344615 1997 Cleavage of beta 4 integrin by matrilysin.
9148753 1997 Degradation of decorin by matrix metalloproteinases: identification of the cleavage sites, kinetic analyses and transforming growth factor-beta1 release.
8978768 1996 Mapping of the metalloproteinase gene matrilysin (MMP7) to human chromosome 11q21-->q22.
8921407 1996 Fine physical mapping of the human matrix metalloproteinase genes clustered on chromosome 11q22.3.
8786845 1995 Matrix metalloproteinases degrade myelin basic protein.
8294454 1994 Structure and expression of the human gene for the matrix metalloproteinase matrilysin.
8216228 1993 Fibroblast and neutrophil collagenases cleave at two sites in the cartilage aggrecan interglobular domain.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7980522 1994 Matrilysin is much more efficient than other matrix metalloproteinases in the proteolytic inactivation of alpha 1-antitrypsin.
7896811 1995 Matrix metalloproteinase 7 (matrilysin) from human rectal carcinoma cells. Activation of the precursor, interaction with other matrix metalloproteinases and enzymic properties.
7756291 1995 Matrilysin-inhibitor complexes: common themes among metalloproteases.
7694569 1993 Matrix metalloproteinases cleave at two distinct sites on human cartilage link protein.
2844164 1988 The collagenase gene family in humans consists of at least four members.
2550050 1989 Pump-1 cDNA codes for a protein with characteristics similar to those of classical collagenase family members.
2253219 1990 Purification and characterization of extracellular matrix-degrading metalloproteinase, matrin (pump-1), secreted from human rectal carcinoma cell line.
1497627 1992 Molecular characterization of a low-molecular-mass matrix metalloproteinase secreted by glomerular mesangial cells as PUMP-1.