Property Summary

NCBI Gene PubMed Count 29
PubMed Score 42.49
PubTator Score 42.72

Knowledge Summary

Patent

No data available

Gene RIF (16)

PMID Text
25429835 These results proved for the first time that epilysin expression was significantly elevated in glioblastoma
24710352 A decreased level of IL-33 and an elevated concentration of MMP-28 were found in coronary heart disease patients and correlated with disease severity.
24167355 MMP28 mRNA expression is highest in healthy tissues when compared to diseased periodontal tissues.
23803888 Inhibition of BCMO1 expression is associated with increased invasiveness of colon cancer cells and increased expression of MMP7 and MMP28. beta-Carotene can upregulate BCMO1 and reverse these effects.
23549873 Data established a seven-gene (AR, ESR2, GATA3, GBX2, KRT16, MMP28 and WNT11) prognostic signature to define a subset of triple-negative breast cancer (TNBC).
22040290 Over-expression of MMP28 provides protection against apoptosis induced by either serum-deprivation or treatment with a protein kinase inhibitor.
21801383 Gene expression of MMP28 in the intervertebral disk is not regulated by inflammatory mechanisms, is donor-dependent and cannot be positively or negatively linked to the grade of degeneration and only weakly to the occurrence of trauma.
21723775 basal expression of MMP-2, MMP-9, MMP-28, and Filaggrin was evaluated in oral keratinocytes to collect information about ability of cigarette smoke to modify basal expression pattern of these key enzymes in the absence of clinical signs in oral epithelium
21615884 MMP28 is frequently overexpressed during progression of gastric carcinoma, and contributes to tumor cell invasion and metastasis.
20144149 MMP28 gene expression is regulated by Sp1 transcription factor acetylation.
20003223 Findings presented here show the first documentation of intervertebral disc expression and production of MMP28
19921252 Expression of MMP-21 and MMP-28 seems to associate with the Merkel cell carcinoma of lesser malignant potential.
19379669 Epilysin (MMP-28) is deposited to the basolateral extracellular matrix of epithelial cells.
19375502 Data demonstrate that expression of MMP28 alters keratinocyte phenotype towards a more adhesive, less migratory behaviour.
18778487 Results suggest inhibition of MMP-28 may be beneficial under conditions of dysmyelination.
12164918 Epilysin (MMP-28) expression is associated with cell proliferation during epithelial repair.

AA Sequence

MVARVGLLLRALQLLLWGHLDAQPAERGGQELRKEAEAFLEKYGYLNEQVPKAPTSTRFSDAIRAFQWVS      1 - 70
QLPVSGVLDRATLRQMTRPRCGVTDTNSYAAWAERISDLFARHRTKMRRKKRFAKQGNKWYKQHLSYRLV     71 - 140
NWPEHLPEPAVRGAVRAAFQLWSNVSALEFWEAPATGPADIRLTFFQGDHNDGLGNAFDGPGGALAHAFL    141 - 210
PRRGEAHFDQDERWSLSRRRGRNLFVVLAHEIGHTLGLTHSPAPRALMAPYYKRLGRDALLSWDDVLAVQ    211 - 280
SLYGKPLGGSVAVQLPGKLFTDFETWDSYSPQGRRPETQGPKYCHSSFDAITVDRQQQLYIFKGSHFWEV    281 - 350
AADGNVSEPRPLQERWVGLPPNIEAAAVSLNDGDFYFFKGGRCWRFRGPKPVWGLPQLCRAGGLPRHPDA    351 - 420
ALFFPPLRRLILFKGARYYVLARGGLQVEPYYPRSLQDWGGIPEEVSGALPRPDGSIIFFRDDRYWRLDQ    421 - 490
AKLQATTSGRWATELPWMGCWHANSGSALF                                            491 - 520
//

Text Mined References (31)

PMID Year Title
25429835 2015 Epilysin is overexpressed in glioblastoma and related to clinical outcome of patients.
24710352 2014 Characterization of interleukin-33 and matrix metalloproteinase-28 in serum and their association with disease severity in patients with coronary heart disease.
24385575 2014 MMP28 and macrophage polarization: orchestrating the attack of the mac.
24167355 2013 mRNA expression of MMP-28 (Epilysin) in gingival tissues of chronic and aggressive periodontitis patients: a reverse transcriptase PCR study.
23964118 2014 MMP28 promotes macrophage polarization toward M2 cells and augments pulmonary fibrosis.
23803888 2013 ?,?-carotene 15,15'-monooxygenase and its substrate ?-carotene modulate migration and invasion in colorectal carcinoma cells.
23549873 2013 Identification of prognosis-relevant subgroups in patients with chemoresistant triple-negative breast cancer.
22040290 2011 Epilysin (matrix metalloproteinase-28) contributes to airway epithelial cell survival.
21801383 2011 Human MMP28 expression is unresponsive to inflammatory stimuli and does not correlate to the grade of intervertebral disc degeneration.
21723775 2011 Chronic exposure to cigarette smoke increases matrix metalloproteinases and Filaggrin mRNA expression in oral keratinocytes: role of nicotine stimulation.
21615884 2011 MMP28 (epilysin) as a novel promoter of invasion and metastasis in gastric cancer.
20144149 2010 MMP28 gene expression is regulated by Sp1 transcription factor acetylation.
20003223 2009 Matrix metalloproteinase 28, a novel matrix metalloproteinase, is constitutively expressed in human intervertebral disc tissue and is present in matrix of more degenerated discs.
19921252 2009 Expression of MMP-10, MMP-21, MMP-26, and MMP-28 in Merkel cell carcinoma.
19379669 2009 Epilysin (MMP-28) is deposited to the basolateral extracellular matrix of epithelial cells.
19375502 2009 Expression and function of matrix metalloproteinase (MMP)-28.
18778487 2008 MMP-28 as a regulator of myelination.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15953044 Effect of in vitro mechanical compression on Epilysin (matrix metalloproteinase-28) expression in hypertrophic scars.
15593191 2004 Matrix metalloproteinase 28/epilysin expression in cartilage from patients with rheumatoid arthritis and osteoarthritis: comment on the article by Kevorkian et al.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15185874 2004 Differential expression of three matrix metalloproteinases, MMP-19, MMP-26, and MMP-28, in normal and inflamed intestine and colon cancer.
14730609 2004 Expression profiling of metalloproteinases and their inhibitors in cartilage.
14506071 2003 Analyses of all matrix metalloproteinase members in leukocytes emphasize monocytes as major inflammatory mediators in multiple sclerosis.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12164918 2002 Epilysin (MMP-28) expression is associated with cell proliferation during epithelial repair.
11574168 2001 Promoter characterization of the human and mouse epilysin (MMP-28) genes.
11255011 2001 MMP-28, a new human matrix metalloproteinase with an unusual cysteine-switch sequence is widely expressed in tumors.
11121398 2001 Epilysin, a novel human matrix metalloproteinase (MMP-28) expressed in testis and keratinocytes and in response to injury.