Property Summary

NCBI Gene PubMed Count 21
PubMed Score 26.26
PubTator Score 17.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma -1.600 4.1e-07
psoriasis -1.500 9.9e-05
osteosarcoma -2.192 1.2e-09
ependymoma -1.700 5.4e-15
glioblastoma -1.400 1.0e-04
atypical teratoid / rhabdoid tumor -1.300 3.7e-05
group 4 medulloblastoma 1.700 1.7e-03
medulloblastoma, large-cell -1.500 3.8e-05
adult high grade glioma -1.400 3.5e-04
pilocytic astrocytoma -1.400 1.3e-06
non primary Sjogren syndrome sicca 1.100 1.6e-02
ovarian cancer -1.200 6.2e-10

Gene RIF (11)

PMID Text
26304632 Polymorphisms in MAP3K3, MMP24 and IGF1R are associated with greater height and act additively on height in children of an admixed population.
24669030 In absolute mRNA levels, significant differences were found in expression of MMP2, MMP24, and MMP25 in gastric carcinoma compared with superficial gastritis.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20587546 Observational study of gene-disease association. (HuGE Navigator)
20546612 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19403421 MMP-24 gene silencing by RNAi can suppress the invasiveness of ovarian cancer SKOV(3) cells in vitro.
18062926 These results suggest more than one human MT5-MMP transcript may exist in the central nervous system.
17952761 MT5-MMP is expressed in normal human endometrium and there is enhanced exprestion in endometrium from patients with entometriosis with strongest signal in epithelial cells.
14990567 MT5-MMP retrieval to the plasma membrane is regulated by Mint-3 by binding to its carboxyl end motif EWV
12661033 down-regulation of most MT-MMPs is typical for prostate carcinoma; seems to occur mainly in epithelial cells

AA Sequence

MPRSRGGRAAPGPPPPPPPPGQAPRWSRWRVPGRLLLLLLPALCCLPGAARAAAAAAGAGNRAAVAVAVA      1 - 70
RADEAEAPFAGQNWLKSYGYLLPYDSRASALHSAKALQSAVSTMQQFYGIPVTGVLDQTTIEWMKKPRCG     71 - 140
VPDHPHLSRRRRNKRYALTGQKWRQKHITYSIHNYTPKVGELDTRKAIRQAFDVWQKVTPLTFEEVPYHE    141 - 210
IKSDRKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNANHDGNDLFLVA    211 - 280
VHELGHALGLEHSSDPSAIMAPFYQYMETHNFKLPQDDLQGIQKIYGPPAEPLEPTRPLPTLPVRRIHSP    281 - 350
SERKHERQPRPPRPPLGDRPSTPGTKPNICDGNFNTVALFRGEMFVFKDRWFWRLRNNRVQEGYPMQIEQ    351 - 420
FWKGLPARIDAAYERADGRFVFFKGDKYWVFKEVTVEPGYPHSLGELGSCLPREGIDTALRWEPVGKTYF    421 - 490
FKGERYWRYSEERRATDPGYPKPITVWKGIPQAPQGAFISKEGYYTYFYKGRDYWKFDNQKLSVEPGYPR    491 - 560
NILRDWMGCNQKEVERRKERRLPQDDVDIMVTINDVPGSVNAVAVVIPCILSLCILVLVYTIFQFKNKTG    561 - 630
PQPVTYYKRPVQEWV                                                           631 - 645
//

Text Mined References (21)

PMID Year Title
26304632 2015 Association Study of GWAS-Derived Loci with Height in Brazilian Children: Importance of MAP3K3, MMP24 and IGF1R Polymorphisms for Height Variation.
24669030 2014 Expression of the matrix metalloproteases 2, 14, 24, and 25 and tissue inhibitor 3 as potential molecular markers in advanced human gastric cancer.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20587546 2010 Interferon gamma receptor 2 gene variants are associated with liver fibrosis in patients with chronic hepatitis C infection.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19403421 2009 [Inhibitory effects of RNA interference on MMP-24 expression and invasiveness of ovarian cancer SKOV(3) cells].
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18839057 2008 Molecular genetics of adult ADHD: converging evidence from genome-wide association and extended pedigree linkage studies.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18062926 2007 Identification of a novel human MT5-MMP transcript variant in multipotent NT2 cells.
17952761 2007 Expression of membrane-type 5 matrix metalloproteinase in human endometrium and endometriosis.
14990567 2004 Mint-3 regulates the retrieval of the internalized membrane-type matrix metalloproteinase, MT5-MMP, to the plasma membrane by binding to its carboxyl end motif EWV.
12879005 2003 Cleavage of metastasis suppressor gene product KiSS-1 protein/metastin by matrix metalloproteinases.
12661033 2003 mRNA expression of the five membrane-type matrix metalloproteinases MT1-MT5 in human prostatic cell lines and their down-regulation in human malignant prostatic tissue.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11457723 2001 Upregulated expression of human membrane type-5 matrix metalloproteinase in kidneys from diabetic patients.
10640822 1999 Assignment of the genes for membrane-type-4 matrix metalloproteinase (Mmp17, MMP17) to mouse chromosome 5, human chromosome band 12q24.3 and membrane-type-5 matrix metalloproteinase (Mmp24, MMP24) to mouse chromosome 2 and human chromosome band 20q11.2-->q12, respectively, by radiation hybrid and in situ hybridization.
10419448 1999 Matrix metalloproteinases.
10363975 1999 Identification and characterization of human MT5-MMP, a new membrane-bound activator of progelatinase a overexpressed in brain tumors.