Property Summary

Ligand Count 33
NCBI Gene PubMed Count 56
PubMed Score 59.54
PubTator Score 54.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adrenocortical carcinoma 2.056 4.5e-02
adult high grade glioma 1.700 3.9e-03
astrocytic glioma 1.700 8.5e-03
Astrocytoma, Pilocytic 2.600 3.4e-10
cystic fibrosis -1.526 3.3e-04
facioscapulohumeral dystrophy 2.300 3.0e-03
glioblastoma 1.100 3.7e-02
invasive ductal carcinoma -1.336 2.6e-02
lung carcinoma 3.100 2.7e-16
medulloblastoma, large-cell -1.500 4.4e-02
oligodendroglioma 1.100 1.9e-04
osteosarcoma 2.791 3.5e-03
ovarian cancer -1.200 2.0e-08
pituitary cancer 2.200 2.4e-03

Gene RIF (31)

AA Sequence

MILLTFSTGRRLDFVHHSGVFFLQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQ      1 - 70
SALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYALTGQKWQHKHITYSIKNVT     71 - 140
PKVGDPETRKAIRRAFDVWQNVTPLTFEEVPYSELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAY    141 - 210
FPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPN    211 - 280
DDLQGIQKIYGPPDKIPPPTRPLPTVPPHRSIPPADPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTL    281 - 350
AILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTTLQ    351 - 420
PGYPHDLITLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITVWKGIPESPQGA    421 - 490
FVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDRVKEGHSPPDDVDIVIKLDNTAS    491 - 560
TVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILYCKRSMQEWV                           561 - 607
//

Text Mined References (57)

PMID Year Title