Property Summary

NCBI Gene PubMed Count 52
PubMed Score 52.28
PubTator Score 54.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma 1.700 8.5e-03
oligodendroglioma 1.100 1.9e-04
osteosarcoma 2.791 3.5e-03
glioblastoma 1.100 3.7e-02
cystic fibrosis -2.324 4.1e-06
medulloblastoma, large-cell -1.500 4.4e-02
adrenocortical carcinoma 2.056 4.5e-02
adult high grade glioma 1.700 3.9e-03
pilocytic astrocytoma 2.600 3.0e-10
invasive ductal carcinoma -1.651 1.8e-03
lung carcinoma 3.300 2.0e-24
ovarian cancer -1.200 2.0e-08
pituitary cancer 2.200 2.4e-03
facioscapulohumeral dystrophy 2.300 3.0e-03

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (27)

PMID Text
26605780 results suggest that miR-145 functions as a tumor metastasis suppressor gene by down-regulating MMP16 and may be a potential target in osteosarcoma treatment
26002729 These results demonstrate that the MT3-MMP promoter is frequently hypermethylated in colorectal cancer and that downregulation of MT3-MMP may be important for cell migration in colorectal cancer.
25808867 MMP16 is a putative indicator of adverse melanoma prognosis.
25017509 Expression of MMP-16 in HTB9 and T24 cells increases following transforming growth factorbeta1 treatment.
24989599 the results support a role for MMP16 in promoting invasive properties of the meningioma tumours
24755270 E2F1 acts as a transcriptional activator for MMPs and directly enhances MMP transcription by binding to E2F1 binding sequences in the promoter, or indirectly activates MMPs (MMP-9 and MMP-16)through enhanced Sp1 and NF-kappa B
23796692 The overexpression of miR-146b-5p in glioblastoma cell lines led to MMP16 mRNA silencing, MMP2 inactivation, and the inhibition of tumour cell migration and invasion.
22348245 Data show that MMP16 is regulated by miR-146a in spontaneously differentiated Caco-2 cells.
22164270 MT3-MMP is a matrix-dependent modifier of the invasive tumor cell functions during melanoma progression
21823013 Matrix metalloproteinase 16 (MMP16) was a downstream target of miR-146b-5p.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20673868 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20587546 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20207250 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19265686 miR-146b is involved in glioma cell migration and invasion by targeting MMP16; implicating miR-146b as a metastasis-inhibiting miRNA in glioma
19240061 Observational study of gene-disease association. (HuGE Navigator)
18784838 MMP16 polymorphisms appear to influence not only the pulmonary expression and function of MMP16 but also the risk of bronchopulmonary dysplasia
18784838 Observational study of gene-disease association. (HuGE Navigator)
17419254 We have demonstrated the expression of MT3-MMP in hepatocellular carcinoma tissues (HCC) and that the expression in HCC significantly correlates with capsular invasion.
17217338 Chondroitin-4-sulfate, which is expressed on tumour cell surface, can function to bind to pro-MMP-2 and facilitate its activation by MT3-MMP-expressing tumour cells to enhance invasion and metastasis
16983145 Type-3 metalloproteinases, are identified as the triggering agents that independently confer cancer cells with the ability to proteolytically efface the BM scaffolding, initiate the assembly of invasive pseudopodia, and propagate transmigration.
15044209 MT3-MMP is not only important in matrix degradation but also may affect the function of focal adhesions through FAK cleavage.
14741217 Results report the structure of the catalytic domain (cd) of the membrane-type matrix metalloproteinase MT3-MMP/MMP-16 in complex with the hydroxamic acid inhibitor batimastat.
12661033 down-regulation of most MT-MMPs is typical for prostate carcinoma; seems to occur mainly in epithelial cells

AA Sequence

MILLTFSTGRRLDFVHHSGVFFLQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQ      1 - 70
SALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYALTGQKWQHKHITYSIKNVT     71 - 140
PKVGDPETRKAIRRAFDVWQNVTPLTFEEVPYSELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAY    141 - 210
FPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPN    211 - 280
DDLQGIQKIYGPPDKIPPPTRPLPTVPPHRSIPPADPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTL    281 - 350
AILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTTLQ    351 - 420
PGYPHDLITLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITVWKGIPESPQGA    421 - 490
FVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDRVKEGHSPPDDVDIVIKLDNTAS    491 - 560
TVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILYCKRSMQEWV                           561 - 607
//

Text Mined References (53)

PMID Year Title
27229514 2016 Biochemical and spectroscopic characterization of the catalytic domain of MMP16 (cdMMP16).
26605780 2015 MicroRNA-145 Suppresses Osteosarcoma Metastasis via Targeting MMP16.
26002729 2015 Promoter hypermethylation of membrane type 3 matrix metalloproteinase is associated with cell migration in colorectal adenocarcinoma.
25808867 2015 MMP16 Mediates a Proteolytic Switch to Promote Cell-Cell Adhesion, Collagen Alignment, and Lymphatic Invasion in Melanoma.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
25017509 2014 Transforming growth factor??1 induces epithelial?mesenchymal transition and increased expression of matrix metalloproteinase?16 via miR?200b downregulation in bladder cancer cells.
24989599 2015 A role for matrix remodelling proteins in invasive and malignant meningiomas.
24970228 2014 Prion fragment peptides are digested with membrane type matrix metalloproteinases and acquire enzyme resistance through Cu²?-binding.
24755270 2014 Differential regulation of MMPs by E2F1, Sp1 and NF-kappa B controls the small cell lung cancer invasive phenotype.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23796692 2013 miR-146b-5p inhibits glioma migration and invasion by targeting MMP16.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
22688191 2012 Genome-wide association study in a Swedish population yields support for greater CNV and MHC involvement in schizophrenia compared with bipolar disorder.
22417934 2012 Genome-wide association study identifies genetic loci associated with body mass index and high density lipoprotein-cholesterol levels during psychopharmacological treatment - a cross-sectional naturalistic study.
22348245 2012 Matrix metalloprotease 16 expression is downregulated by microRNA-146a in spontaneously differentiating Caco-2 cells.
22164270 2011 Membrane-type-3 matrix metalloproteinase (MT3-MMP) functions as a matrix composition-dependent effector of melanoma cell invasion.
21926974 2011 Genome-wide association study identifies five new schizophrenia loci.
21823013 2011 Inhibitory effects of miR-146b-5p on cell migration and invasion of pancreatic cancer by targeting MMP16.
21768085 2011 Membrane-type matrix metalloproteinase-3 regulates neuronal responsiveness to myelin through Nogo-66 receptor 1 cleavage.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20587546 2010 Interferon gamma receptor 2 gene variants are associated with liver fibrosis in patients with chronic hepatitis C infection.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20207250 2010 The association of innate immune response gene polymorphisms and puerperal group A streptococcal sepsis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19265686 2009 microRNA-146b inhibits glioma cell migration and invasion by targeting MMPs.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18784838 2008 Matrix metalloproteinase gene polymorphisms and bronchopulmonary dysplasia: identification of MMP16 as a new player in lung development.
17419254 Overexpression of MT3-MMP in hepatocellular carcinoma correlates with capsular invasion.
17217338 2007 Cell surface chondroitin sulfate glycosaminoglycan in melanoma: role in the activation of pro-MMP-2 (pro-gelatinase A).
16983145 2006 A cancer cell metalloprotease triad regulates the basement membrane transmigration program.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15044209 2004 Cleavage of focal adhesion kinase in vascular smooth muscle cells overexpressing membrane-type matrix metalloproteinases.
14741217 2004 Crystal structure of the catalytic domain of MMP-16/MT3-MMP: characterization of MT-MMP specific features.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14645246 2004 The low density lipoprotein receptor-related protein LRP is regulated by membrane type-1 matrix metalloproteinase (MT1-MMP) proteolysis in malignant cells.
12879005 2003 Cleavage of metastasis suppressor gene product KiSS-1 protein/metastin by matrix metalloproteinases.
12661033 2003 mRNA expression of the five membrane-type matrix metalloproteinases MT1-MT5 in human prostatic cell lines and their down-regulation in human malignant prostatic tissue.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11278606 2001 Melanoma chondroitin sulfate proteoglycan regulates matrix metalloproteinase-dependent human melanoma invasion into type I collagen.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
10949161 2000 Structural differences of matrix metalloproteinases. Homology modeling and energy minimization of enzyme-substrate complexes.
10419448 1999 Matrix metalloproteinases.
9396633 1997 Identification of soluble type of membrane-type matrix metalloproteinase-3 formed by alternatively spliced mRNA.
9119382 1997 Assignment of the human genes for membrane-type-1, -2, and -3 matrix metalloproteinases (MMP14, MMP15, and MMP16) to 14q12.2, 16q12.2-q21, and 8q21, respectively, by in situ hybridization.
9110174 1997 Large-scale concatenation cDNA sequencing.
9092507 1997 Expression of three membrane-type matrix metalloproteinases (MT-MMPs) in rat vascular smooth muscle cells and characterization of MT3-MMPs with and without transmembrane domain.
9070935 1997 Genes of the membrane-type matrix metalloproteinase (MT-MMP) gene family, MMP14, MMP15, and MMP16, localize to human chromosomes 14, 16, and 8, respectively.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
7559440 1995 Identification of the second membrane-type matrix metalloproteinase (MT-MMP-2) gene from a human placenta cDNA library. MT-MMPs form a unique membrane-type subclass in the MMP family.