Property Summary

NCBI Gene PubMed Count 33
PubMed Score 42.28
PubTator Score 43.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma -1.200 1.2e-05
osteosarcoma 1.592 7.5e-05
atypical teratoid / rhabdoid tumor 1.800 2.6e-05
inflammatory breast cancer 1.200 9.7e-03

Protein-protein Interaction (2)

Gene RIF (18)

PMID Text
25973093 In conclusion, MT2-MMP is involved in gastric cancer invasion and metastasis and may serve as an independent prognostic factor for gastric cancer patients.
25031779 our data suggest that MT2-MMP expression positively involves in non-small cell lung cancer and might play an important role in promoting the tumor progression and intra-tumoral angiogenesis
23228395 HLA-G expression involved in tumor invasiveness or metastasis may rely on the NK cytotoxicity inhibition and induction of MMP-15 expression in ovarian cancer.
22768148 MMP-15 is up-regulated in preeclampsia, but does not cleave endoglin to produce soluble endoglin.
22576687 MMP-15 and MMP-19 are upregulated during colorectal tumorigenesis
21751260 Data show that MT2-MMP was a novel hypoxia-responsive gene and was upregulated by HIF-1alpha under hypoxia.
21036765 The intensity of immunochemical staining of MT2-MMP was significantly positively correlated to the intratumoral angiogenesis of esophageal cancer tissues.
20673868 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20587546 Observational study of gene-disease association. (HuGE Navigator)
20586027 MMP2 activity is associated with an increase in MT2-MMP expression and with lymph node metastasis.
20452482 Observational study of gene-disease association. (HuGE Navigator)
20117087 These results indicate MT2-MMP might be involved in the cancer progression more than or equal to MT1-MMP independently of MMP-2 and MT1-MMP.
19913121 Observational study of gene-disease association. (HuGE Navigator)
17029196 Data show that MMP15 may be relevant with carcinogenesis, development and metastasis of adenoid cystic carcinoma, and different metastasis potential may result from different subtype of MMPs gene family.
16983145 Type-2 metalloproteinases, are identified as the triggering agents that independently confer cancer cells with the ability to proteolytically efface the BM scaffolding, initiate the assembly of invasive pseudopodia, and propagate transmigration.
16825197 Data show that the MT2-MMP catalytic domain has a higher propensity than that of MT1-MMP to initiate cleavage of the MMP-2 prodomain in the absence of TIMP-2.
12661033 down-regulation of most MT-MMPs is typical for prostate carcinoma; seems to occur mainly in epithelial cells

AA Sequence

MGSDPSAPGRPGWTGSLLGDREEAARPRLLPLLLVLLGCLGLGVAAEDAEVHAENWLRLYGYLPQPSRHM      1 - 70
STMRSAQILASALAEMQRFYGIPVTGVLDEETKEWMKRPRCGVPDQFGVRVKANLRRRRKRYALTGRKWN     71 - 140
NHHLTFSIQNYTEKLGWYHSMEAVRRAFRVWEQATPLVFQEVPYEDIRLRRQKEADIMVLFASGFHGDSS    141 - 210
PFDGTGGFLAHAYFPGPGLGGDTHFDADEPWTFSSTDLHGNNLFLVAVHELGHALGLEHSSNPNAIMAPF    211 - 280
YQWKDVDNFKLPEDDLRGIQQLYGTPDGQPQPTQPLPTVTPRRPGRPDHRPPRPPQPPPPGGKPERPPKP    281 - 350
GPPVQPRATERPDQYGPNICDGDFDTVAMLRGEMFVFKGRWFWRVRHNRVLDNYPMPIGHFWRGLPGDIS    351 - 420
AAYERQDGRFVFFKGDRYWLFREANLEPGYPQPLTSYGLGIPYDRIDTAIWWEPTGHTFFFQEDRYWRFN    421 - 490
EETQRGDPGYPKPISVWQGIPASPKGAFLSNDAAYTYFYKGTKYWKFDNERLRMEPGYPKSILRDFMGCQ    491 - 560
EHVEPGPRWPDVARPPFNPHGGAEPGADSAEGDVGDGDGDFGAGVNKDGGSRVVVQMEEVARTVNVVMVL    561 - 630
VPLLLLLCVLGLTYALVQMQRKGAPRVLLYCKRSLQEWV                                   631 - 669
//

Text Mined References (36)

PMID Year Title
25973093 2015 Increased MT2-MMP expression in gastric cancer patients is associated with poor prognosis.
25031779 2014 MT2-MMP expression associates with tumor progression and angiogenesis in human lung cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
23228395 2013 Multiple steps of HLA-G in ovarian carcinoma metastasis: alter NK cytotoxicity and induce matrix metalloproteinase-15 (MMP-15) expression.
23154389 2013 Regulation of endodermal differentiation of human embryonic stem cells through integrin-ECM interactions.
22768148 2012 MMP-15 is upregulated in preeclampsia, but does not cleave endoglin to produce soluble endoglin.
22576687 2012 Matrix metalloproteinases 15 and 19 are stromal regulators of colorectal cancer development from the early stages.
21946350 2011 Genome-wide association and large-scale follow up identifies 16 new loci influencing lung function.
21751260 2011 Transcriptional upregulation of MT2-MMP in response to hypoxia is promoted by HIF-1? in cancer cells.
21036765 2010 Immunochemical staining of MT2-MMP correlates positively to angiogenesis of human esophageal cancer.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20587546 2010 Interferon gamma receptor 2 gene variants are associated with liver fibrosis in patients with chronic hepatitis C infection.
20586027 Prognostic value of membrane type 1 and 2 matrix metalloproteinase expression and gelatinase A activity in bladder cancer.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20117087 2010 The role of MT2-MMP in cancer progression.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
17029196 2006 [Analysis of differential expression genes related to different metastasis potential of adenoid cystic carcinoma using restriction fragments differential display PCR].
16983145 2006 A cancer cell metalloprotease triad regulates the basement membrane transmigration program.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16825197 2006 TIMP independence of matrix metalloproteinase (MMP)-2 activation by membrane type 2 (MT2)-MMP is determined by contributions of both the MT2-MMP catalytic and hemopexin C domains.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15248212 2004 Elevation of activated protein C in synovial joints in rheumatoid arthritis and its correlation with matrix metalloproteinase 2.
14645246 2004 The low density lipoprotein receptor-related protein LRP is regulated by membrane type-1 matrix metalloproteinase (MT1-MMP) proteolysis in malignant cells.
12661033 2003 mRNA expression of the five membrane-type matrix metalloproteinases MT1-MT5 in human prostatic cell lines and their down-regulation in human malignant prostatic tissue.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11824946 2002 Gelatinase expression and activity in the synovium and skin of patients with erosive psoriatic arthritis.
10949161 2000 Structural differences of matrix metalloproteinases. Homology modeling and energy minimization of enzyme-substrate complexes.
10419448 1999 Matrix metalloproteinases.
9461298 1997 Membrane-type matrix metalloproteinases 1 and 2 exhibit broad-spectrum proteolytic capacities comparable to many matrix metalloproteinases.
9119382 1997 Assignment of the human genes for membrane-type-1, -2, and -3 matrix metalloproteinases (MMP14, MMP15, and MMP16) to 14q12.2, 16q12.2-q21, and 8q21, respectively, by in situ hybridization.
9070935 1997 Genes of the membrane-type matrix metalloproteinase (MT-MMP) gene family, MMP14, MMP15, and MMP16, localize to human chromosomes 14, 16, and 8, respectively.
7649159 1995 cDNA sequence and mRNA tissue distribution of a novel human matrix metalloproteinase with a potential transmembrane segment.
7559440 1995 Identification of the second membrane-type matrix metalloproteinase (MT-MMP-2) gene from a human placenta cDNA library. MT-MMPs form a unique membrane-type subclass in the MMP family.