Property Summary

Ligand Count 343
NCBI Gene PubMed Count 476
PubMed Score 1087.86
PubTator Score 978.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Cancer 2499 5.647 2.8
Arthritis 290 3.39 1.7
Vascular disease 319 3.369 1.7

Expression

  Differential Expression (16)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 1.8e-03
atypical teratoid / rhabdoid tumor 1.600 2.5e-06
cystic fibrosis 1.297 2.7e-05
ependymoma 1.800 1.7e-10
glioblastoma 1.700 6.6e-05
group 4 medulloblastoma 1.200 4.3e-03
inflammatory breast cancer 1.500 2.8e-02
lung adenocarcinoma 1.700 2.0e-06
lung carcinoma -1.100 4.8e-19
malignant mesothelioma -1.600 5.4e-06
non-small cell lung cancer 1.197 1.1e-15
osteosarcoma 3.202 2.2e-06
pancreatic cancer 1.100 5.3e-04
pediatric high grade glioma 1.200 2.2e-04
primary pancreatic ductal adenocarcinoma 1.261 1.0e-02
psoriasis -2.200 3.9e-04

 GWAS Trait (1)

Protein-protein Interaction (9)

Gene RIF (423)

AA Sequence

MSPAPRPPRCLLLPLLTLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQK      1 - 70
FYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYAT     71 - 140
YEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIG    141 - 210
GDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQ    211 - 280
QLYGGESGFPTKMPPQPRTTSRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVM    281 - 350
DGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALF    351 - 420
WMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQK    421 - 490
LKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGGGAVSAAAVVLPVLLLLLVLAVGLAVF    491 - 560
FFRRHGTPRRLLYCQRSLLDKV                                                    561 - 582
//

Text Mined References (480)

PMID Year Title