Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.08
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 5.5e-06

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.500 5.5e-06

Gene RIF (1)

AA Sequence

MAPSLWKGLVGIGLFALAHAAFSAAQHRSYMRLTEKEDESLPIDIVLQTLLAFAVTCYGIVHIAGEFKDM      1 - 70
DATSELKNKTFDTLRNHPSFYVFNHRGRVLFRPSDTANSSNQDALSSNTSLKLRKLESLRR              71 - 131
//

Text Mined References (18)

PMID Year Title