Property Summary

Ligand Count 307
NCBI Gene PubMed Count 271
PubMed Score 4375.79
PubTator Score 2454.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count
Mammary Neoplasms 425
Disease Target Count
Acute diarrhea 2
Chronic heart failure 46
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.7
Liver cancer 604 0.0 0.5

Expression

  Differential Expression (21)

Disease log2 FC p
acute myeloid leukemia -1.400 8.4e-03
acute quadriplegic myopathy 1.034 2.1e-03
axial spondyloarthropathy 1.300 3.6e-02
Breast cancer -4.600 1.6e-40
breast carcinoma -1.700 2.3e-05
colon cancer 2.800 4.2e-02
cutaneous lupus erythematosus 2.500 1.2e-03
cystic fibrosis 5.656 7.1e-08
ductal carcinoma in situ -3.100 1.1e-04
facioscapulohumeral dystrophy -1.800 7.8e-03
intraductal papillary-mucinous carcinoma... -1.100 4.0e-02
invasive ductal carcinoma -4.200 2.3e-05
lung adenocarcinoma -2.500 2.2e-16
lung cancer 2.300 2.6e-05
lung carcinoma -2.300 1.4e-11
malignant mesothelioma 1.700 1.5e-06
non-small cell lung cancer -1.757 3.4e-09
osteosarcoma -1.791 9.7e-03
periodontitis 1.600 7.7e-31
ulcerative colitis 2.400 5.8e-05
urothelial carcinoma -2.800 2.3e-02

PDB (11)

Gene RIF (240)

AA Sequence

MGKSESQMDITDINTPKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYATYDDGICKSSDCIKSAARLI      1 - 70
QNMDATTEPCTDFFKYACGGWLKRNVIPETSSRYGNFDILRDELEVVLKDVLQEPKTEDIVAVQKAKALY     71 - 140
RSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKKVLINLFVGTDDK    141 - 210
NSVNHVIHIDQPRLGLPSRDYYECTGIYKEACTAYVDFMISVARLIRQEERLPIDENQLALEMNKVMELE    211 - 280
KEIANATAKPEDRNDPMLLYNKMTLAQIQNNFSLEINGKPFSWLNFTNEIMSTVNISITNEEDVVVYAPE    281 - 350
YLTKLKPILTKYSARDLQNLMSWRFIMDLVSSLSRTYKESRNAFRKALYGTTSETATWRRCANYVNGNME    351 - 420
NAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKRAEEKALAIKERIGYPDDIVSND    421 - 490
NKLNNEYLELNYKEDEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAAVVNAFYSSGRNQIVFPAGIL    491 - 560
QPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKDGDLVDWWTQQSASNFKEQSQCMVYQYGNFS    561 - 630
WDLAGGQHLNGINTLGENIADNGGLGQAYRAYQNYIKKNGEEKLLPGLDLNHKQLFFLNFAQVWCGTYRP    631 - 700
EYAVNSIKTDVHSPGNFRIIGTLQNSAEFSEAFHCRKNSYMNPEKKCRVW                        701 - 750
//

Text Mined References (276)

PMID Year Title