Property Summary

NCBI Gene PubMed Count 21
PubMed Score 13.52
PubTator Score 103.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.023 4.1e-02
ependymoma 1.600 1.2e-02
oligodendroglioma 1.400 3.3e-03
psoriasis -1.400 6.5e-08
osteosarcoma -2.269 7.1e-05
astrocytoma 1.200 1.8e-02
atypical teratoid / rhabdoid tumor 1.400 1.1e-04
glioblastoma 1.500 6.1e-05
medulloblastoma, large-cell 1.900 7.1e-05
sonic hedgehog group medulloblastoma 1.100 2.8e-04
aldosterone-producing adenoma -1.269 3.4e-02
ovarian cancer -2.400 4.8e-11

Gene RIF (13)

PMID Text
26910886 Evaluation of the conservation of ChREBP and MondoA sequences demonstrate that MondoA is better conserved and potentially mediates more ancient function in glucose metabolism.
25640402 Knockdown of MondoA, or its dimerization partner Mlx, blocks Myc-induced reprogramming of multiple metabolic pathways, resulting in apoptosis
25332233 regulatory relationship between mTOR and the MondoA-TXNIP axis that we propose contributes to glucose homeostasis
25179879 These results suggest that C771G polymorphism of MLXIPL gene is associated with coronary stenosis and its severity.
23520550 Suppression of Txnip by lipopolysaccharide is accompanied by a decrease of the glucose sensing transcription factor MondoA in the nuclei.
22748921 An important contribution of MondoA to leukemia aggressiveness, which makes MondoA a potential candidate for targeted treatment of acute lymphoblastic leukemia.
21908621 the MondoA-TXNIP regulatory circuit has a role in the hexose transport curb, although other redundant pathways also contribute
20844768 Induction of TXNIP under lactic acidosis is caused by the activation of the glucose-sensing helix-loop-helix transcriptional complex MondoA:Mlx, which is usually triggered upon glucose exposure.
20385767 Glucose is required at two additional steps to stimulate the transcription activation function of MondoA-Mlx complexes.
19706488 Data suggest that glutamine-dependent mitochondrial anapleurosis dictates glucose uptake and aerobic glycolysis by blocking MondoA:Mlx-dependent transcriptional activation of TXNIP.
18458340 These studies suggest a key role for MondoA:Mlx complexes in the adaptive transcriptional response to changes in extracellular glucose concentration and peripheral glucose uptake.
16782875 Endogenous MondoA and Mlx associate with mitochondria in primary skeletal muscle.
12446771 Data show that for both MondoA and Mlx, the C-terminal domain CRM-1 has cytoplasmic localization activity that is required by the protein monomers to accumulate in the cytoplasm.

AA Sequence

MAADVFMCSPRRPRSRGRQVLLKPQVSEDDDDSDTDEPSPPPASGAATPARAHASAAPPPPRAGPGREEP      1 - 70
PRRQQIIHSGHFMVSSPHREHPPKKGYDFDTVNKQTCQTYSFGKTSSCHLSIDASLTKLFECMTLAYSGK     71 - 140
LVSPKWKNFKGLKLQWRDKIRLNNAIWRAWYMQYLEKRKNPVCHFVTPLDGSVDVDEHRRPEAITTEGKY    141 - 210
WKSRIEIVIREYHKWRTYFKKRLQQHKDEDLSSLVQDDDMLYWHKHGDGWKTPVPMEEDPLLDTDMLMSE    211 - 280
FSDTLFSTLSSHQPVAWPNPREIAHLGNADMIQPGLIPLQPNLDFMDTFEPFQDLFSSSRSIFGSMLPAS    281 - 350
ASAPVPDPNNPPAQESILPTTALPTVSLPDSLIAPPTAPSLAHMDEQGCEHTSRTEDPFIQPTDFGPSEP    351 - 420
PLSVPQPFLPVFTMPLLSPSPAPPPISPVLPLVPPPATALNPPAPPTFHQPQKFAGVNKAPSVITHTASA    421 - 490
TLTHDAPATTFSQSQGLVITTHHPAPSAAPCGLALSPVTRPPQPRLTFVHPKPVSLTGGRPKQPHKIVPA    491 - 560
PKPEPVSLVLKNARIAPAAFSGQPQAVIMTSGPLKREGMLASTVSQSNVVIAPAAIARAPGVPEFHSSIL    561 - 630
VTDLGHGTSSPPAPVSRLFPSTAQDPLGKGEQVPLHGGSPQVTVTGPSRDCPNSGQASPCASEQSPSPQS    631 - 700
PQNNCSGKSDPKNVAALKNRQMKHISAEQKRRFNIKMCFDMLNSLISNNSKLTSHAITLQKTVEYITKLQ    701 - 770
QERGQMQEEARRLREEIEELNATIISCQQLLPATGVPVTRRQFDHMKDMFDEYVKTRTLQNWKFWIFSII    771 - 840
IKPLFESFKGMVSTSSLEELHRTALSWLDQHCSLPILRPMVLSTLRQLSTSTSILTDPAQLPEQASKAVT    841 - 910
RIGKRLGES                                                                 911 - 919
//

Text Mined References (26)

PMID Year Title
26910886 2016 Contrasting Patterns in the Evolution of Vertebrate MLX Interacting Protein (MLXIP) and MLX Interacting Protein-Like (MLXIPL) Genes.
25640402 2015 Deregulated Myc requires MondoA/Mlx for metabolic reprogramming and tumorigenesis.
25332233 2015 MondoA-Mlx transcriptional activity is limited by mTOR-MondoA interaction.
25179879 2015 C771G (His241Gln) polymorphism of MLXIPL gene, TG levels and coronary artery disease: a case control study.
23840567 2013 The Association Study between Twenty One Polymorphisms in Seven Candidate Genes and Coronary Heart Diseases in Chinese Han Population.
23756994 2013 Classification and evolutionary analysis of the basic helix-loop-helix gene family in the green anole lizard, Anolis carolinensis.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
23520550 2013 Thioredoxin-interacting protein gene expression via MondoA is rapidly and transiently suppressed during inflammatory responses.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22748921 2012 MondoA is highly overexpressed in acute lymphoblastic leukemia cells and modulates their metabolism, differentiation and survival.
21908621 2011 MondoA senses non-glucose sugars: regulation of thioredoxin-interacting protein (TXNIP) and the hexose transport curb.
20844768 2010 Lactic acidosis triggers starvation response with paradoxical induction of TXNIP through MondoA.
20385767 2010 Glucose controls nuclear accumulation, promoter binding, and transcriptional activity of the MondoA-Mlx heterodimer.
19706488 2009 Glutamine-dependent anapleurosis dictates glucose uptake and cell growth by regulating MondoA transcriptional activity.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18458340 2008 Glucose sensing by MondoA:Mlx complexes: a role for hexokinases and direct regulation of thioredoxin-interacting protein expression.
16782875 2006 MondoA-Mlx heterodimers are candidate sensors of cellular energy status: mitochondrial localization and direct regulation of glycolysis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12826659 2003 MSAP is a novel MIR-interacting protein that enhances neurite outgrowth and increases myosin regulatory light chain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446771 2002 A novel heterodimerization domain, CRM1, and 14-3-3 control subcellular localization of the MondoA-Mlx heterocomplex.
11073985 2000 MondoA, a novel basic helix-loop-helix-leucine zipper transcriptional activator that constitutes a positive branch of a max-like network.
10048485 1998 Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.