Property Summary

Ligand Count 56
NCBI Gene PubMed Count 17
PubMed Score 129.88
PubTator Score 38.67

Knowledge Summary

Patent (7,988)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.600 1.7e-04

Gene RIF (8)

AA Sequence

MGSPWNGSDGPEGAREPPWPALPPCDERRCSPFPLGALVPVTAVCLCLFVVGVSGNVVTVMLIGRYRDMR      1 - 70
TTTNLYLGSMAVSDLLILLGLPFDLYRLWRSRPWVFGPLLCRLSLYVGEGCTYATLLHMTALSVERYLAI     71 - 140
CRPLRARVLVTRRRVRALIAVLWAVALLSAGPFLFLVGVEQDPGISVVPGLNGTARIASSPLASSPPLWL    141 - 210
SRAPPPSPPSGPETAEAAALFSRECRPSPAQLGALRVMLWVTTAYFFLPFLCLSILYGLIGRELWSSRRP    211 - 280
LRGPAASGRERGHRQTVRVLLVVVLAFIICWLPFHVGRIIYINTEDSRMMYFSQYFNIVALQLFYLSASI    281 - 350
NPILYNLISKKYRAAAFKLLLARKSRPRGFHRSRDTAGEVAGDTGGDTVGYTETSANVKTMG            351 - 412
//

Text Mined References (17)

PMID Year Title