Property Summary

NCBI Gene PubMed Count 42
PubMed Score 88.87
PubTator Score 59.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma -1.900 3.2e-06
astrocytic glioma -1.200 4.6e-02
ependymoma 1.200 1.8e-02
oligodendroglioma 1.500 3.9e-03
psoriasis -1.300 2.1e-03
group 4 medulloblastoma 3.200 2.3e-08
ulcerative colitis -1.048 8.4e-04
intraductal papillary-mucinous adenoma (... 2.700 1.7e-03
intraductal papillary-mucinous carcinoma... 2.500 7.4e-03
progressive supranuclear palsy 1.600 5.6e-03
Breast cancer -1.100 2.9e-03
acute myeloid leukemia -1.700 4.2e-02
ovarian cancer -3.000 4.4e-08
pituitary cancer 1.400 3.2e-07
sarcoidosis -1.100 2.5e-03

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
651704 screening 1633 / 1491 / 345094 Inhibition of the MLL-AF4-AF9 Interaction in Pediatric Leukemia Measured in Biochemical System Using Plate Reader - 2160-01_Inhibitor_SinglePoint_HTS_Activity
651715 summary 0 / 0 / 0 Broad Institute Inhibition of the MLL-AF4-AF9 Interaction in Pediatric Leukemia Inhibitor Probe Project
720495 confirmatory 306 / 19 / 209 Inhibition of the MLL-AF4-AF9 Interaction in Pediatric Leukemia Measured in Biochemical System Using Plate Reader - 2160-01_Inhibitor_Dose_CherryPick_Activity

Gene RIF (30)

PMID Text
25509985 AF9 and its homolog ENL directly interact with AF4.
25417107 Studies identified the evolutionarily conserved Af9 YEATS domain as a novel acetyllysine-binding module and established a direct link between histone acetylation and DOT1L-mediated H3K79 methylation in transcription control.
24565118 HIV-1 Tat forms at least two distinct P-TEFb-containing complexes. Tatcom1 is composed of P-TEFb, AF9, ENL, ELL, AFF1, AFF4, and PAF1, presenting strong CTD-kinase activity, while Tatcom2 consists of 7SK, LARP7, and MEPCE with two molecules of Tat/P-TEFb
23891621 Interaction with CBX8 precludes AF9-DOT1L binding.
23624644 Abrogation of Rac1 signaling causes DNA double-strand breaks in acute monocytic leukemia cells harbouring the MLL-AF9 oncogene.
23518577 HIV-1 Tat forms at least two distinct P-TEFb-containing complexes. Tatcom1 is composed of P-TEFb, AF9, ENL, ELL, AFF1, AFF4, and PAF1, presenting strong CTD-kinase activity, while Tatcom2 consists of 7SK, LARP7, and MEPCE with two molecules of Tat/P-TEFb
23403462 We demonstrate that leukemogenic activity of MLL-AF9 requires RUVBL2 (RuvB-like 2), an AAA+ ATPase family member that functions in a wide range of cellular processes, including chromatin remodeling and transcriptional regulation.
23260655 AF9 functions as a signaling hub that regulates transcription through dynamic recruitment of cofactors in normal hematopoiesis and in acute leukemia.
23178754 neonatal cells expressing MLL-AF9 were enriched for gene signatures associated with poor prognosis
22567366 HIV-1 Tat forms at least two distinct P-TEFb-containing complexes. Tatcom1 is composed of P-TEFb, AF9, ENL, ELL, AFF1, AFF4, and PAF1, presenting strong CTD-kinase activity, while Tatcom2 consists of 7SK, LARP7, and MEPCE with two molecules of Tat/P-TEFb
22427200 Identification of genes that define transcription factor networks and important genetic pathways acting during progression of leukemia induced by MLL fusion oncogenes.
22355797 HIV-1 Tat forms at least two distinct P-TEFb-containing complexes. Tatcom1 is composed of P-TEFb, AF9, ENL, ELL, AFF1, AFF4, and PAF1, presenting strong CTD-kinase activity, while Tatcom2 consists of 7SK, LARP7, and MEPCE with two molecules of Tat/P-TEFb
22309891 we identified a novel fusion gene consisted of PAX5 and MLLT3 during progression from chronic phase to blastic phase in chronic myeloid leukemia
21959947 MLL-AF9-negative U937 cells but not positive MLL-AF9 THP-1 cells, suggesting that the toxocity ting was not antibody-mediated by antibodies against MLL-AF9 protein.
21937695 Within the group of MLL-AF9-positive patients, high BRE expression predicted superior survival, while normal BRE expression predicted extremely poor survival.
21360054 HIV-1 Tat forms at least two distinct P-TEFb-containing complexes. Tatcom1 is composed of P-TEFb, AF9, ENL, ELL, AFF1, AFF4, and PAF1, presenting strong CTD-kinase activity, while Tatcom2 consists of 7SK, LARP7, and MEPCE with two molecules of Tat/P-TEFb
20874815 our data suggest: (i) C14ORF28, GNB2L1, MLLT3, DRD2 and DARPP-32 are important in the pathogenesis of schizophrenia and bipolar disorder
20689807 Observational study of gene-disease association. (HuGE Navigator)
20471949 HIV-1 Tat forms at least two distinct P-TEFb-containing complexes. Tatcom1 is composed of P-TEFb, AF9, ENL, ELL, AFF1, AFF4, and PAF1, presenting strong CTD-kinase activity, while Tatcom2 consists of 7SK, LARP7, and MEPCE with two molecules of Tat/P-TEFb
20471948 HIV-1 Tat forms at least two distinct P-TEFb-containing complexes. Tatcom1 is composed of P-TEFb, AF9, ENL, ELL, AFF1, AFF4, and PAF1, presenting strong CTD-kinase activity, while Tatcom2 consists of 7SK, LARP7, and MEPCE with two molecules of Tat/P-TEFb
20395514 Ras activation seems to complement the MLLT3-MLL oncogene in transformation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19864429 AF17 competes with AF9 to bind Dot1a, decreases Dot1a nuclear expression by possibly facilitating its nuclear export, and relieves Dot1a.AF9-mediated repression of alpha-ENaC and other target genes.
19591803 Diversin, containing several nuclear localization signals, translocates to the nucleus, where it interacts with the transcription factor AF9.
18538732 Expression of MLL-AF9 in human CD34+ cells induces acute myeloid, lymphoid, or mixed-lineage leukemia in immunodeficient mice.
18371451 MLLT3 as a regulator of early erythroid and megakaryocytic cell fate in the human system.
17581865 demonstrate coimmunoprecipitation of the All1/Af4 and All1/Af9 fusions with Drosha, disrupted by treatment with DNase I
16328057 Down-regulation of AF9 is not necessary to abolish malignant phenotypes by induction of terminal monocyte-macrophage differentiation in leukaemic cells carrying t(9;11)(p22;q23).
16215946 The patients with immunophenotype of Pre-B-acute lymphoblastic leukemia were found to carry: MLL/AF9.
16086288 In the Acute Myeloid Leukemia patients, detected MLL rearrangements consisting of MLL/AF6, MLL/AF9, MLL/AF17 , MLL/ELL and MLL partial tandem duplication. MLL rearrangement include chromosome translocation and partial tandem duplication.

AA Sequence

MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPP      1 - 70
YKVEESGYAGFILPIEVYFKNKEEPRKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKAGG     71 - 140
DPNRSIHTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSFSKPHKLMKEHKEKPSKD    141 - 210
SREHKSAFKEPSRDHNKSSKESSKKPKENKPLKEEKIVPKMAFKEPKPMSKEPKPDSNLLTITSGQDKKA    211 - 280
PSKRPPISDSEELSAKKRKKSSSEALFKSFSSAPPLILTCSADKKQIKDKSHVKMGKVKIESETSEKKKS    281 - 350
TLPPFDDIVDPNDSDVEENISSKSDSEQPSPASSSSSSSSSFTPSQTRQQGPLRSIMKDLHSDDNEEESD    351 - 420
EVEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILEVKSPIKQSKS    421 - 490
DKQIKNGECDKAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQS    491 - 560
YLETSGTS                                                                  561 - 568
//

Text Mined References (56)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25509985 2014 An AF9/ENL-targted peptide with therapeutic potential in mixed lineage leukemias.
25417107 2014 AF9 YEATS domain links histone acetylation to DOT1L-mediated H3K79 methylation.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
23891621 2013 CBX8, a component of the Polycomb PRC1 complex, modulates DOT1L-mediated gene expression through AF9/MLLT3.
23624644 2013 Rac1 signaling protects monocytic AML cells expressing the MLL-AF9 oncogene from caspase-mediated apoptotic death.
23403462 2013 The AAA+ ATPase RUVBL2 is a critical mediator of MLL-AF9 oncogenesis.
23260655 2013 Leukemia fusion target AF9 is an intrinsically disordered transcriptional regulator that recruits multiple partners via coupled folding and binding.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23178754 2013 MLL-AF9-mediated immortalization of human hematopoietic cells along different lineages changes during ontogeny.
23145062 2012 Human ALKBH4 interacts with proteins associated with transcription.
22895430 2012 The super elongation complex (SEC) family in transcriptional control.
22427200 2012 An insertional mutagenesis screen identifies genes that cooperate with Mll-AF9 in a murine leukemogenesis model.
22309891 2012 Sequential array comparative genomic hybridization analysis identifies copy number changes during blastic transformation of chronic myeloid leukemia.
22195968 2011 The little elongation complex regulates small nuclear RNA transcription.
21959947 2012 Immune response as a possible mechanism of long-lasting disease control in spontaneous remission of MLL/AF9-positive acute myeloid leukemia.
21937695 2011 High BRE expression predicts favorable outcome in adult acute myeloid leukemia, in particular among MLL-AF9-positive patients.
21729782 2011 Human mediator subunit MED26 functions as a docking site for transcription elongation factors.
20874815 2011 Altered expression and coregulation of dopamine signalling genes in schizophrenia and bipolar disorder.
20689807 2010 Genetic variation and antioxidant response gene expression in the bronchial airway epithelium of smokers at risk for lung cancer.
20471948 2010 HIV-1 Tat and host AFF4 recruit two transcription elongation factors into a bifunctional complex for coordinated activation of HIV-1 transcription.
20395514 2010 Acute myeloid leukemia with t(9;11)(p21-22;q23): common properties of dysregulated ras pathway signaling and genomic progression characterize de novo and therapy-related cases.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20203130 2010 Linking H3K79 trimethylation to Wnt signaling through a novel Dot1-containing complex (DotCom).
20159561 2010 AFF4, a component of the ELL/P-TEFb elongation complex and a shared subunit of MLL chimeras, can link transcription elongation to leukemia.
20153263 2010 A higher-order complex containing AF4 and ENL family proteins with P-TEFb facilitates oncogenic and physiologic MLL-dependent transcription.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19864429 2009 AF17 competes with AF9 for binding to Dot1a to up-regulate transcription of epithelial Na+ channel alpha.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19591803 2009 The planar cell polarity (PCP) protein Diversin translocates to the nucleus to interact with the transcription factor AF9.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18538732 2008 Microenvironment determines lineage fate in a human model of MLL-AF9 leukemia.
18371451 2008 MLLT3 regulates early human erythroid and megakaryocytic cell fate.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17581865 2007 Oncogenic All1 fusion proteins target Drosha-mediated microRNA processing.
16328057 2006 Down-regulation of MLL-AF9, MLL and MYC expression is not obligatory for monocyte-macrophage maturation in AML-M5 cell lines carrying t(9;11)(p22;q23).
16215946 2005 [Detection of fusion genes resulting from chromosome abnormalities in childhood acute lymphoblastic leukemia].
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16086288 2005 [Application of reverse transcription-multiplex nested PCR to detect MLL rearrangement in AML-M4/M5].
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15381384 2004 Identification of two MLL-MLLT3 (alias MLL-AF9) chimeric transcripts in the MOLM-13 cell line.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14603337 2004 MLL fusion partners AF4 and AF9 interact at subnuclear foci.
12776190 2003 The mixed lineage leukemia fusion partner AF9 binds specific isoforms of the BCL-6 corepressor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11439343 2001 The polycomb protein MPc3 interacts with AF9, an MLL fusion partner in t(9;11)(p22;q23) acute leukemias.
11313972 2001 The ENL moiety of the childhood leukemia-associated MLL-ENL oncoprotein recruits human Polycomb 3.
10898795 2000 BCoR, a novel corepressor involved in BCL-6 repression.
8506309 1993 Genes on chromosomes 4, 9, and 19 involved in 11q23 abnormalities in acute leukemia share sequence homology and/or common motifs.
8414510 1993 MLLT3 gene on 9p22 involved in t(9;11) leukemia encodes a serine/proline rich protein homologous to MLLT1 on 19p13.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.