| Tbio | Protein AF-10 |
Probably involved in transcriptional regulation. In vitro or as fusion protein with KMT2A/MLL1 has transactivation activity. Binds to cruciform DNA.
This gene encodes a transcription factor and has been identified as a partner gene involved in several chromosomal rearrangements resulting in various leukemias. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2010]
This gene encodes a transcription factor and has been identified as a partner gene involved in several chromosomal rearrangements resulting in various leukemias. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2010]
Comments
| Disease | Target Count | P-value |
|---|---|---|
| psoriasis | 6685 | 9.4e-11 |
| osteosarcoma | 7933 | 1.9e-06 |
| medulloblastoma, large-cell | 6234 | 5.3e-06 |
| Pick disease | 1893 | 1.1e-05 |
| sonic hedgehog group medulloblastoma | 1482 | 2.5e-05 |
| atypical teratoid / rhabdoid tumor | 4369 | 4.2e-04 |
| Rheumatoid Arthritis | 1170 | 7.6e-04 |
| glioblastoma | 5572 | 1.7e-03 |
| oligodendroglioma | 2849 | 4.6e-03 |
| astrocytic glioma | 2241 | 5.7e-03 |
| ependymoma | 2514 | 6.5e-03 |
| primitive neuroectodermal tumor | 3031 | 7.9e-03 |
| aldosterone-producing adenoma | 664 | 1.5e-02 |
| non primary Sjogren syndrome sicca | 840 | 2.4e-02 |
| lung cancer | 4473 | 3.7e-02 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Breast cancer | 3098 | 0.0 | 2.0 |
| Disease of cellular proliferation | 3 | 0.0 | 2.0 |
| ovarian cancer | 8491 | 0.0 | 2.0 |
| Disease | Target Count |
|---|---|
| Melanoma | 261 |
| Meningioma | 27 |
| Renal Cell Carcinoma | 199 |
| acute T cell leukemia | 17 |
| Disease | log2 FC | p |
|---|---|---|
| Rheumatoid Arthritis | 1.800 | 7.6e-04 |
| astrocytic glioma | -1.600 | 5.7e-03 |
| ependymoma | -1.700 | 6.5e-03 |
| oligodendroglioma | -1.500 | 4.6e-03 |
| osteosarcoma | 2.708 | 1.9e-06 |
| sonic hedgehog group medulloblastoma | 2.000 | 2.5e-05 |
| atypical teratoid / rhabdoid tumor | 2.000 | 4.2e-04 |
| glioblastoma | 1.600 | 1.7e-03 |
| medulloblastoma, large-cell | 2.200 | 5.3e-06 |
| primitive neuroectodermal tumor | 1.700 | 7.9e-03 |
| lung cancer | 1.600 | 3.7e-02 |
| non primary Sjogren syndrome sicca | -1.100 | 2.4e-02 |
| aldosterone-producing adenoma | -1.010 | 1.5e-02 |
| psoriasis | -1.200 | 9.4e-11 |
| Pick disease | 1.800 | 1.1e-05 |
| ovarian cancer | -1.400 | 4.2e-08 |
| PMID | Text | |
|---|---|---|
| 26439302 | The PZP domain of AF10 senses unmodified H3K27 to regulate DOT1L-mediated methylation of H3K79. | |
| 25464900 | Results provide evidence that transformation driven by MLL fusions as well as the recurrent AML-associated NUP98-NSD1 fusion oncogene is critically dependent on the ability of AF10 to stimulate DOT1L activity. | |
| 24755950 | we report that variants at the MLLT10 locus are unlikely to alter risk of glioma, and they have no prognostic value among patients with high-grade tumors (glioblastoma). | |
| 23673860 | In pediatric T-acute lymphoblastic leukemia, we have identified 2 RNA processing genes, that is, HNRNPH1/5q35 and DDX3X/Xp11.3 as new MLLT10 fusion partners. | |
| 23670296 | detection of PICALM-MLLT10 fusion transcript occurs in 7% of children with T-lineage ALL and is not associated with a poorer outcome for patients treated with contemporary, intensive chemotherapy | |
| 22064352 | results strongly indicate that the differential regulation of these three genes is not due to the break point effect but as a consequence of the CALM/AF10 fusion gene expression, though the mechanism of regulation is not well understood | |
| 21804547 | a new susceptibility locus for meningioma at 10p12.31 (MLLT10, rs11012732, odds ratio = 1.46, P(combined) = 1.88 x 10(-14)) was identified. | |
| 21706055 | In leukemia cells, full-length CALM-AF10 localized to the nucleus with no consistent effect on growth factor endocyctosis, and suppressed histone H3 lysine 79 methylation regardless of the presence of clathrin | |
| 20628086 | Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) | |
| 19913121 | Observational study of gene-disease association. (HuGE Navigator) | |
| 19443658 | the CALM-AF10 fusion protein can also greatly reduce global H3K79 methylation in both human and murine leukemic cells by disrupting the AF10-mediated association of hDOT1L with chromatin | |
| 18037964 | CALM(PICALM)/AF10 fusion protein might interfere with normal Ikaros (IKZF1)function, and thereby block lymphoid differentiation in CALM/AF10 positive leukemias. | |
| 17868029 | Data show that the nuclear isoform of FLRG lacks an intrinsic transactivation domain, but enhances AF10-mediated transcription, probably through promoting the homo-oligomerization of AF10, thus facilitating the recruitment of co-activators. | |
| 16215946 | The patients with immunophenotype of Pre-B-acute lymphoblastic leukemia were found to carry: MLL/AF10. | |
| 12482966 | data reveal new properties for the leucine zipper domain and thus might provide new clues to understanding the mechanisms by which AF10 fusion proteins in which the PHD domain is lost might trigger leukemias in humans | |
| 12453419 | ALL1 is involved in remodeling, acetylating, deacetylating, and methylating nucleosomes and/or free histones | |
| 12127405 | FISH analysis in infant AML-M5 showed a complex rearrangement between chromosomes 10 and 11, disrupting the MLL gene, a paracentric inversion of the 11q13-q23 fragment translocated to 10p12. AF10 was the fusion partner gene of MLL in this rearrangement. |
MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVYCDGHGCSVAVHQACYGIVQVPTGPWFCRK 1 - 70 CESQERAARVRCELCPHKDGALKRTDNGGWAHVVCALYIPEVQFANVSTMEPIVLQSVPHDRYNKTCYIC 71 - 140 DEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKSKRGSNR 141 - 210 SYDQSLSDSSSHSQDKHHEKEKKKYKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTYTSTSNNSISGSLK 211 - 280 RLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQ 281 - 350 GSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGL 351 - 420 PSTSAVTSQPKSFENSPGDLGNSSLPTAGYKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENV 421 - 490 SHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQYRHDGACPTTTFSEL 491 - 560 LNAIHNGIYNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTL 561 - 630 SGSSLSQAPSHMYGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRYDQ 631 - 700 PGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKER 701 - 770 LQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQS 771 - 840 TSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAIN 841 - 910 GIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNS 911 - 980 QQLTPEQHQAFLYQLMQHHHQQHHQPELQQLQIPGPTQIPINNLLAGTQAPPLHTATTNPFLTIHGDNAS 981 - 1050 QKVARLSDKTGPVAQEKS 1051 - 1068 //
| PMID | Year | Title | |
|---|---|---|---|
| 26496610 | 2015 | A human interactome in three quantitative dimensions organized by stoichiometries and abundances. | |
| 26439302 | 2015 | The PZP Domain of AF10 Senses Unmodified H3K27 to Regulate DOT1L-Mediated Methylation of H3K79. | |
| 25464900 | 2014 | AF10 regulates progressive H3K79 methylation and HOX gene expression in diverse AML subtypes. | |
| 25218447 | 2014 | Uncovering global SUMOylation signaling networks in a site-specific manner. | |
| 24755950 | 2015 | Brain tumor risk according to germ-line variation in the MLLT10 locus. | |
| 23673860 | 2013 | New MLLT10 gene recombinations in pediatric T-acute lymphoblastic leukemia. | |
| 23670296 | 2013 | Detection of PICALM-MLLT10 (CALM-AF10) and outcome in children with T-lineage acute lymphoblastic leukemia. | |
| 23535730 | 2013 | GWAS meta-analysis and replication identifies three new susceptibility loci for ovarian cancer. | |
| 23535729 | 2013 | Large-scale genotyping identifies 41 new loci associated with breast cancer risk. | |
| 23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. | |
| 22064352 | 2012 | CALM/AF10-positive leukemias show upregulation of genes involved in chromatin assembly and DNA repair processes and of genes adjacent to the breakpoint at 10p12. | |
| 21804547 | 2011 | Common variation at 10p12.31 near MLLT10 influences meningioma risk. | |
| 21706055 | 2012 | The clathrin-binding domain of CALM-AF10 alters the phenotype of myeloid neoplasms in mice. | |
| 20628086 | 2010 | Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study. | |
| 20203130 | 2010 | Linking H3K79 trimethylation to Wnt signaling through a novel Dot1-containing complex (DotCom). | |
| 20068231 | 2010 | Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. | |
| 19913121 | 2009 | Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip. | |
| 19690332 | 2009 | Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. | |
| 19443658 | 2009 | Global reduction of the epigenetic H3K79 methylation mark and increased chromosomal instability in CALM-AF10-positive leukemias. | |
| 19413330 | 2009 | Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. | |
| 18669648 | 2008 | A quantitative atlas of mitotic phosphorylation. | |
| 18037964 | 2008 | The leukemogenic CALM/AF10 fusion protein alters the subcellular localization of the lymphoid regulator Ikaros. | |
| 18029348 | 2008 | Toward a confocal subcellular atlas of the human proteome. | |
| 17868029 | 2007 | AF10-dependent transcription is enhanced by its interaction with FLRG. | |
| 17525332 | 2007 | ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. | |
| 16215946 | 2005 | [Detection of fusion genes resulting from chromosome abnormalities in childhood acute lymphoblastic leukemia]. | |
| 15851025 | 2005 | hDOT1L links histone methylation to leukemogenesis. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 15164054 | 2004 | The DNA sequence and comparative analysis of human chromosome 10. | |
| 14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. | |
| 12482966 | 2003 | The leucine zipper motif of the Drosophila AF10 homologue can inhibit PRE-mediated repression: implications for leukemogenic activity of human MLL-AF10 fusions. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 12453419 | 2002 | ALL-1 is a histone methyltransferase that assembles a supercomplex of proteins involved in transcriptional regulation. | |
| 12127405 | 2002 | Molecular and fluorescence in situ hybridization analysis of a 10;11 rearrangement in a case of infant acute monocytic leukemia. | |
| 11986236 | 2002 | The AF10 leucine zipper is required for leukemic transformation of myeloid progenitors by MLL-AF10. | |
| 11774384 | 2002 | Characterization and potential function of a novel testis-specific nucleoporin BS-63. | |
| 11756182 | 2002 | The MLL fusion partner AF10 binds GAS41, a protein that interacts with the human SWI/SNF complex. | |
| 11423977 | 2001 | The synovial sarcoma associated protein SYT interacts with the acute leukemia associated protein AF10. | |
| 10997963 | 2000 | Cytogenetic and molecular evidence of marrow involvement in extramedullary acute myeloid leukaemia. | |
| 10860745 | 2000 | Biochemical analyses of the AF10 protein: the extended LAP/PHD-finger mediates oligomerisation. | |
| 9737689 | 1998 | Alternative splicing in wild-type AF10 and CALM cDNAs and in AF10-CALM and CALM-AF10 fusion cDNAs produced by the t(10;11)(p13-14;q14-q21) suggests a potential role for truncated AF10 polypeptides. | |
| 7888665 | 1995 | A novel class of zinc finger/leucine zipper genes identified from the molecular cloning of the t(10;11) translocation in acute leukemia. |
