Property Summary

NCBI Gene PubMed Count 33
PubMed Score 130.20
PubTator Score 69.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Rheumatoid Arthritis 1.800 7.6e-04
astrocytic glioma -1.600 5.7e-03
ependymoma -1.700 6.5e-03
oligodendroglioma -1.500 4.6e-03
osteosarcoma 2.708 1.9e-06
sonic hedgehog group medulloblastoma 2.000 2.5e-05
atypical teratoid / rhabdoid tumor 2.000 4.2e-04
glioblastoma 1.600 1.7e-03
medulloblastoma, large-cell 2.200 5.3e-06
primitive neuroectodermal tumor 1.700 7.9e-03
lung cancer 1.600 3.7e-02
non primary Sjogren syndrome sicca -1.100 2.4e-02
aldosterone-producing adenoma -1.010 1.5e-02
psoriasis -1.200 9.4e-11
Pick disease 1.800 1.1e-05
ovarian cancer -1.400 4.2e-08

Gene RIF (17)

PMID Text
26439302 The PZP domain of AF10 senses unmodified H3K27 to regulate DOT1L-mediated methylation of H3K79.
25464900 Results provide evidence that transformation driven by MLL fusions as well as the recurrent AML-associated NUP98-NSD1 fusion oncogene is critically dependent on the ability of AF10 to stimulate DOT1L activity.
24755950 we report that variants at the MLLT10 locus are unlikely to alter risk of glioma, and they have no prognostic value among patients with high-grade tumors (glioblastoma).
23673860 In pediatric T-acute lymphoblastic leukemia, we have identified 2 RNA processing genes, that is, HNRNPH1/5q35 and DDX3X/Xp11.3 as new MLLT10 fusion partners.
23670296 detection of PICALM-MLLT10 fusion transcript occurs in 7% of children with T-lineage ALL and is not associated with a poorer outcome for patients treated with contemporary, intensive chemotherapy
22064352 results strongly indicate that the differential regulation of these three genes is not due to the break point effect but as a consequence of the CALM/AF10 fusion gene expression, though the mechanism of regulation is not well understood
21804547 a new susceptibility locus for meningioma at 10p12.31 (MLLT10, rs11012732, odds ratio = 1.46, P(combined) = 1.88 x 10(-14)) was identified.
21706055 In leukemia cells, full-length CALM-AF10 localized to the nucleus with no consistent effect on growth factor endocyctosis, and suppressed histone H3 lysine 79 methylation regardless of the presence of clathrin
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19443658 the CALM-AF10 fusion protein can also greatly reduce global H3K79 methylation in both human and murine leukemic cells by disrupting the AF10-mediated association of hDOT1L with chromatin
18037964 CALM(PICALM)/AF10 fusion protein might interfere with normal Ikaros (IKZF1)function, and thereby block lymphoid differentiation in CALM/AF10 positive leukemias.
17868029 Data show that the nuclear isoform of FLRG lacks an intrinsic transactivation domain, but enhances AF10-mediated transcription, probably through promoting the homo-oligomerization of AF10, thus facilitating the recruitment of co-activators.
16215946 The patients with immunophenotype of Pre-B-acute lymphoblastic leukemia were found to carry: MLL/AF10.
12482966 data reveal new properties for the leucine zipper domain and thus might provide new clues to understanding the mechanisms by which AF10 fusion proteins in which the PHD domain is lost might trigger leukemias in humans
12453419 ALL1 is involved in remodeling, acetylating, deacetylating, and methylating nucleosomes and/or free histones
12127405 FISH analysis in infant AML-M5 showed a complex rearrangement between chromosomes 10 and 11, disrupting the MLL gene, a paracentric inversion of the 11q13-q23 fragment translocated to 10p12. AF10 was the fusion partner gene of MLL in this rearrangement.

AA Sequence

MVSSDRPVSLEDEVSHSMKEMIGGCCVCSDERGWAENPLVYCDGHGCSVAVHQACYGIVQVPTGPWFCRK      1 - 70
CESQERAARVRCELCPHKDGALKRTDNGGWAHVVCALYIPEVQFANVSTMEPIVLQSVPHDRYNKTCYIC     71 - 140
DEQGRESKAATGACMTCNKHGCRQAFHVTCAQFAGLLCEEEGNGADNVQYCGYCKYHFSKLKKSKRGSNR    141 - 210
SYDQSLSDSSSHSQDKHHEKEKKKYKEKDKHKQKHKKQPEPSPALVPSLTVTTEKTYTSTSNNSISGSLK    211 - 280
RLEDTTARFTNANFQEVSAHTSSGKDVSETRGSEGKGKKSSAHSSGQRGRKPGGGRNPGTTVSAASPFPQ    281 - 350
GSFSGTPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGL    351 - 420
PSTSAVTSQPKSFENSPGDLGNSSLPTAGYKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENV    421 - 490
SHLSVSSASPTSSVASAAGSITSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQYRHDGACPTTTFSEL    491 - 560
LNAIHNGIYNSNDVAVSFPNVVSGSGSSTPVSSSHLPQQSSGHLQQVGALSPSAVSSAAPAVATTQANTL    561 - 630
SGSSLSQAPSHMYGNRSNSSMAALIAQSENNQTDQDLGDNSRNLVGRGSSPRGSLSPRSPVSSLQIRYDQ    631 - 700
PGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKER    701 - 770
LQLLNAQLSVPFPTITANPSPSHQIHTFSAQTAPTTDSLNSSKSPHIGNSFLPDNSLPVLNQDLTSSGQS    771 - 840
TSSSSALSTPPPAGQSPAQQGSGVSGVQQVNGVTVGALASGMQPVTSTIPAVSAVGGIIGALPGNQLAIN    841 - 910
GIVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNS    911 - 980
QQLTPEQHQAFLYQLMQHHHQQHHQPELQQLQIPGPTQIPINNLLAGTQAPPLHTATTNPFLTIHGDNAS    981 - 1050
QKVARLSDKTGPVAQEKS                                                       1051 - 1068
//

Text Mined References (42)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26439302 2015 The PZP Domain of AF10 Senses Unmodified H3K27 to Regulate DOT1L-Mediated Methylation of H3K79.
25464900 2014 AF10 regulates progressive H3K79 methylation and HOX gene expression in diverse AML subtypes.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24755950 2015 Brain tumor risk according to germ-line variation in the MLLT10 locus.
23673860 2013 New MLLT10 gene recombinations in pediatric T-acute lymphoblastic leukemia.
23670296 2013 Detection of PICALM-MLLT10 (CALM-AF10) and outcome in children with T-lineage acute lymphoblastic leukemia.
23535730 2013 GWAS meta-analysis and replication identifies three new susceptibility loci for ovarian cancer.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22064352 2012 CALM/AF10-positive leukemias show upregulation of genes involved in chromatin assembly and DNA repair processes and of genes adjacent to the breakpoint at 10p12.
21804547 2011 Common variation at 10p12.31 near MLLT10 influences meningioma risk.
21706055 2012 The clathrin-binding domain of CALM-AF10 alters the phenotype of myeloid neoplasms in mice.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20203130 2010 Linking H3K79 trimethylation to Wnt signaling through a novel Dot1-containing complex (DotCom).
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19443658 2009 Global reduction of the epigenetic H3K79 methylation mark and increased chromosomal instability in CALM-AF10-positive leukemias.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18037964 2008 The leukemogenic CALM/AF10 fusion protein alters the subcellular localization of the lymphoid regulator Ikaros.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17868029 2007 AF10-dependent transcription is enhanced by its interaction with FLRG.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16215946 2005 [Detection of fusion genes resulting from chromosome abnormalities in childhood acute lymphoblastic leukemia].
15851025 2005 hDOT1L links histone methylation to leukemogenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12482966 2003 The leucine zipper motif of the Drosophila AF10 homologue can inhibit PRE-mediated repression: implications for leukemogenic activity of human MLL-AF10 fusions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12453419 2002 ALL-1 is a histone methyltransferase that assembles a supercomplex of proteins involved in transcriptional regulation.
12127405 2002 Molecular and fluorescence in situ hybridization analysis of a 10;11 rearrangement in a case of infant acute monocytic leukemia.
11986236 2002 The AF10 leucine zipper is required for leukemic transformation of myeloid progenitors by MLL-AF10.
11774384 2002 Characterization and potential function of a novel testis-specific nucleoporin BS-63.
11756182 2002 The MLL fusion partner AF10 binds GAS41, a protein that interacts with the human SWI/SNF complex.
11423977 2001 The synovial sarcoma associated protein SYT interacts with the acute leukemia associated protein AF10.
10997963 2000 Cytogenetic and molecular evidence of marrow involvement in extramedullary acute myeloid leukaemia.
10860745 2000 Biochemical analyses of the AF10 protein: the extended LAP/PHD-finger mediates oligomerisation.
9737689 1998 Alternative splicing in wild-type AF10 and CALM cDNAs and in AF10-CALM and CALM-AF10 fusion cDNAs produced by the t(10;11)(p13-14;q14-q21) suggests a potential role for truncated AF10 polypeptides.
7888665 1995 A novel class of zinc finger/leucine zipper genes identified from the molecular cloning of the t(10;11) translocation in acute leukemia.