Property Summary

NCBI Gene PubMed Count 14
PubMed Score 8.63
PubTator Score 4.09

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 3.6e-05
Multiple myeloma 1332 4.3e-04


  Differential Expression (2)

Disease log2 FC p
Multiple myeloma 1.018 4.3e-04
ovarian cancer 2.300 3.6e-05

Gene RIF (3)

AA Sequence

FRRLESSGAGGRRAEGPPRLAIQGPEDSPSRQSRRYDW                                    211 - 248

Text Mined References (25)

PMID Year Title