Property Summary

NCBI Gene PubMed Count 23
PubMed Score 35.27
PubTator Score 26.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 1.92056710925575E-16
malignant mesothelioma 3163 3.49412772934383E-6
psoriasis 6685 4.64196771103014E-6
acute quadriplegic myopathy 1157 6.54850365048432E-6
cystic fibrosis 1670 2.09622427447857E-5
Breast cancer 3099 2.88637075976115E-5
osteosarcoma 7933 1.56516634978104E-4
limb girdle muscular dystrophy 2B 74 3.95332150711953E-4
nasopharyngeal carcinoma 1056 6.34521147484201E-4
adrenocortical carcinoma 1427 7.60244140081554E-4
invasive ductal carcinoma 2950 0.00103176801617389
Duchenne muscular dystrophy 602 0.00157849214431494
diabetes mellitus 1663 0.00343454488996533
ovarian cancer 8492 0.00437134862234361
lung cancer 4473 0.00472082647589907
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00606188031638278
tuberculosis 1563 0.00660557249913009
hereditary spastic paraplegia 313 0.0204161183629166
chronic rhinosinusitis 512 0.0407001862383969
Disease Target Count Z-score Confidence
acute myeloid leukemia 785 4.084 2.0
MYELODYSPLASTIC SYNDROME 39 3.896 1.9
Disease Target Count
Leukemia, Acute Myeloid 17

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
psoriasis -1.200 0.000
osteosarcoma 2.219 0.000
posterior fossa group B ependymoma 2.700 0.000
cystic fibrosis 2.436 0.000
Duchenne muscular dystrophy -1.036 0.002
limb girdle muscular dystrophy 2B -1.472 0.000
autosomal dominant Emery-Dreifuss muscul... -1.462 0.006
hereditary spastic paraplegia -1.232 0.020
acute quadriplegic myopathy -2.575 0.000
adrenocortical carcinoma 1.480 0.001
tuberculosis -1.200 0.007
lung cancer -1.400 0.005
diabetes mellitus -1.500 0.003
invasive ductal carcinoma -1.620 0.001
nasopharyngeal carcinoma -1.700 0.001
Breast cancer 1.300 0.000
ovarian cancer 1.600 0.004
chronic rhinosinusitis -1.876 0.041

Synonym

Accession P58340 E9PEU9 Q2TLE3 Q2TLE5 Q8N8F8 Q96MH1
Symbols

Gene

PANTHER Protein Class (1)

PDB

3UAL   3UBW  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Xenopus OMA EggNOG

Gene RIF (11)

PMID Text
23403313 Data indicte that acute myeloid leukemia (AML) with NPM1-MLF1 and AML with NPM1 mutations showed similar immunophenotypical and molecular features, including gene mutation patterns and gene expression profiling (GEP).
23271436 The subcellular localization of full-length human MLF1 is 14-3-3epsilon-independent.
22193965 changes in the subcellular localization of NPM, due to alterations in the relative abundance of NPM and NPM-MLF1 proteins, may contribute to the enhanced myeloid progenitor activity of Npm +/- cells
22151054 Data present the high-resolution crystal structure of this binding motif [MLF1(29-42)pSer34] in complex with 14-3-3epsilon and analyse the interaction with isothermal titration calorimetry.
20471513 MLF1 gene rearrangement is associated with acute myeloid leukemia.
19023099 Observational study of gene-disease association. (HuGE Navigator)
17975119 Observational study of gene-disease association. (HuGE Navigator)
17967869 shuttling of MLF1 is critical for the regulation of cell proliferation and a disturbance in the shuttling balance increases the cell's susceptibility to oncogenic transformation
17854834 Over-expression of MLF1 has little impact on skeletal muscle function in mice; progressive formation of protein aggregates in muscle are not necessarily pathogenic; MLF1 and MRJ may function together to ameliorate the toxic effects of mutant proteins.
14506644 These findings suggest that an NPM/MLF1 fusion is the primary molecular abnormality in t(3;5) MDS and AML with multilineage dysplasia, and that cases with NPM/MLF1 may be clinically distinct from other MDS-associated disease
More...

AA Sequence

MFRMLNSSFEDDPFFSESILAHRENMRQMIRSFSEPFGRDLLSISDGRGRAHNRRGHNDGEDSLTHTDVS      1 - 70
SFQTMDQMVSNMRNYMQKLERNFGQLSVDPNGHSFCSSSVMTYSKIGDEPPKVFQASTQTRRAPGGIKET     71 - 140
RKAMRDSDSGLEKMAIGHHIHDRAHVIKKSKNKKTGDEEVNQEFINMNESDAHAFDEEWQSEVLKYKPGR    141 - 210
HNLGNTRMRSVGHENPGSRELKRREKPQQSPAIEHGRRSNVLGDKLHIKGSSVKSNKK                211 - 268
//

Text Mined References (25)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
23403313 2013 Acute myeloid leukemia with translocation t(3;5): new molecular insights.
23271436 2013 Subcellular localization of full-length human myeloid leukemia factor 1 (MLF1) is independent of 14-3-3 proteins.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22193965 2012 NPM-MLF1 synergizes with Npm haploinsufficiency to enhance myeloid progenitor activity.
22151054 2012 Structural insights of the MLF1/14-3-3 interaction.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20471513 2010 Detection of t(3;5) and NPM1/MLF1 rearrangement in an elderly patient with acute myeloid leukemia: clinical and laboratory study with review of the literature.
More...