Property Summary

NCBI Gene PubMed Count 54
PubMed Score 887.00
PubTator Score 293.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
cutaneous lupus erythematosus -3.400 5.0e-03
psoriasis -1.100 3.0e-02

Gene RIF (51)

PMID Text
27062658 Report automated quantification of proliferation with automated hot-spot selection in phosphohistone H3/MART1 dual-stained stage I/II melanoma.
25602697 Suggest MelanA-negative spindle-cell associated melanoma constitutes a distinct inflammatory phenotype correlated with dense infiltration of CD163 macrophages and loss of E-cadherin.
25495780 Knockdown of T-bet expression in Mart-127-35 -specific T-cell-receptor-engineered human CD4(+) CD25(-) and CD8(+) T cells attenuates effector function.
25329118 Inhibin alpha-subunit, Melan A and MNF116 were not sensitive for pheochromocytomas.
25043574 the presence of antibody and T-cell immune responses directed against the melanocyte-differentiation-antigens MART-1 (Melan-A), tyrosinase and gp100 in patients with melanoma-associated leucoderma, as compared to patients with vitiligo.
24846220 Misinitiation of intrathymic MART-1 transcription and biased TCR usage explain the high frequency of MART-1-specific T cells.
24394300 Melan-A was useful to confirm the diagnosis of lentigo maligna in early lesions and to differentiate these from chronically sun-damaged skin.
23899062 Comprehensive characterization of the marginal and joint distributions for S100, HMB-45, and Melan-A across a large series of cutaneous melanomas revealed diversity of expression across this group of antigens.
22925930 In this study, production of the C terminus of the Melan-A(26-35) epitope requires cleavage within a hydrophobic stretch, after V35. Hence, the standard proteasome is the only proteasome able to produce the C terminus of this epitope.
22820661 melan A (A103) is not expressed in mesotheliomas
22768350 naturally occurring MART-1 melanoma antigen can be taken-up from dying melanoma cells into DC or MAK and both cell types can induce specific CD8(+) T cell cross-presentation thereafter.
22688397 Report diagnostic role of immunohistochemical staining for Melan-A in evaluating primary melanoma and, specifically, in situ melanoma cases.
22529253 The presence of circulating T cells responding to Melan-A or NY-ESO-1 had strong independent prognostic impact on survival in advanced melanoma.
22291187 The modified melan-A long peptides (not their wild-type counterparts) give rise to highly sustained cross-presentation capacity by monocyte-derived dendritic cells and could be used as tumor vaccines for treatment of melanoma patients.
22050092 Aberrant expression of Melan-A and MART-1 in AFX and undifferentiated pleomorphic sarcoma of the skin represents an important diagnostic pitfall with potential for misdiagnosis as melanoma.
21993558 MART-1- and gp100-expressing and -non-expressing melanoma cells are equally proliferative in tumors and clonogenic in vitro.
21760531 we established several CD4 T-cell clones that recognized a peptide that is embedded within Melan-A/MART-121-50, in a HLA-DPB1*0501 restricted manner
21667026 The differential expression of Mart-1 was investigated in four human uveal melanoma cells.
21610457 Both semiscale and fullscale quantitative analyses of Ki67/MART1 stains are valuable diagnostic tools to distinguish melanomas and nevi with a large degree of certainty.
21362015 Translocation of the BCL2 gene on the chromosome band 18q21.3 and MYC translocation to 14q32/IGH or less commonly to 2p11/IGK in an identical cell is termed BCL2 and MYC dual-hit lymphoma/leukemia
21135695 Molecular upstaging of MART-1 using rt-pcr was correlated with prognosis in melanoma patients
20417641 determined the crystal structure of a phosphopeptide derived from melanoma antigen recognized by T cells-1 (pMART-1), selectively expressed by melanomas, in complex with HLA-DR1
19861278 Melanocyte MART-1 may correlate to the autoimmune mechanism in children with vitiligo.
19717472 OA1 interacts with MART-1 at early stages of melanogenesis to control melanosome identity and composition.
19384076 Case Report: Melan-a-positive "pseudomelanocytic nests": a pitfall in the histopathologic and immunohistochemical diagnosis of pigmented lesions on sun-damaged skin.
19320733 Observational study of gene-disease association. (HuGE Navigator)
19317896 T-cell receptor beta chain sequences of Melan-A-specific clonotypes obtained from melanoma patients were highly heterogeneous, but displayed a preferential usage of few TRBV and TRBJ segments.
19050104 the generation of larger numbers of ELAGIGILTV ((MART-1 26-35, A27L)-specific CD8+ T cells correlates negatively with the acquisition of a CD45RA+CCR7- phenotype and cytotoxic capacity.
18976975 Knockdown of melan-A (MLANA) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18626310 results show a complex pattern of changes in the expression of Melan-A in melanomas depending on the location of melanoma cells within individual skin layers
18494818 Increased staining with Melan-A, in an actinic keratosis, or solar lentigo should raise the possibility of a contiguous melanoma in situ.
18337837 Although melan-A-specific T cells were detectable, they are unlikely to be involved in the etiopathogenesis of vitiligo.
18181974 Measurement of Melan-A, gp100, MAGE-3, MIA and tyrosinase represents a prognostic factor and a method for early detection of metastasis and treatment response of melanoma patients.
18097665 these data significantly enlarge the fraction of melanoma patients susceptible to benefit from a Melan-A/MART1 vaccine approach.
18091323 the combinational characterization of calretinin (either by polyclonal or monoclonal antibody), inhibin alpha, and Melan-A expression is of great significance in the differential diagnosis of adrenocortical tumors.
17768347 t cell recaptor antigens and the major histocompatibilyt complex are complexed with this protein.
17719062 Data show that the MAT-1 26-35 and 27-35 peptides adopt strikingly different conformations when bound to HLA-A2.
17227112 HMB-45 and Melan-A combined were positive in 100% of the renal angiomyolipomas.
17082590 Two novel Melan-A/MART-1-derived sequences recognized by CD4 T cells from melanoma patients provide the basis for monitoring of naturally occurring and vaccine-induced Melan-A/MART-1-specific CD4 T cell responses.
17050671 Blocking MAPK signaling augments antigen levels, thereby enhancing Melan-A/MART-1-specific cytotoxic T-cell responses to antigen-negative cells following MEK inhibition treatment.
16814609 Two new Melan-A-derived CD4+ T cell epitopes have been identified that map to the 1-20 and 91-110 regions of the protein and are restricted by HLA-DR11 and HLA-DR52 molecules.
15695812 Data suggest that MART-1 is indispensable for Pmel17 function and thus plays an important role in regulating mammalian pigmentation.
15618925 Melan-A is very useful in distinguishing between desmoplastic melanoma and sclerotic nevi.
15305155 the expression of Melan-A/MART-1 in patient-derived cell cultures may help to identify a group of melanoma patients with prolonged survival
14663359 adrenocortical neoplasms showed strong and diffuse granular cytoplasmic staining for Melan A. No nuclear reaction was observed.
12925214 Antigen-specific T lymphocyte reactivity to MelanA/MART-1 and tyrosinase peptides was not observed ex vivo in our vitiligo patients, and only one patient demonstrated responses to MelanA/MART-1
12819038 Data show that MITF appears to regulate the expression of the SILV and MLANA genes.
12444131 dominant function of TCRAV2 segment in forming the TCR repertoire specific for the human self Ag Melan-A/MART-1
12119345 The high frequency of Melan-A multimer(+) T cells can be explained by the existence of largely cross-reactive subsets of naive CD8(+) T cells displaying multiple specificities.
12072203 Melanosomes from an Achilles tendon clear-cell sarcoma showed expression of the Melan-A gene.
11854361 unexpected high frequency of T cells specific for the self-antigen Melan-A/MART-1 in CD8 single-positive thymocytes from human histocompatibility leukocyte antigen-A2 healthy individuals

AA Sequence

MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVLLLIGCWYCRRRNGYRALMDKSLHVGTQCAL      1 - 70
TRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP                           71 - 118
//

Text Mined References (57)

PMID Year Title
27062658 2016 Automated quantification of proliferation with automated hot-spot selection in phosphohistone H3/MART1 dual-stained stage I/II melanoma.
25602697 2015 MelanA-negative spindle-cell associated melanoma, a distinct inflammatory phenotype correlated with dense infiltration of CD163 macrophages and loss of E-cadherin.
25495780 2015 Knockdown of T-bet expression in Mart-127-35 -specific T-cell-receptor-engineered human CD4(+)  CD25(-) and CD8(+) T cells attenuates effector function.
25329118 2014 Inhibin alpha-subunit, Melan A and MNF116 in pheochromocytomas.
25043574 2014 The antibody response against MART-1 differs in patients with melanoma-associated leucoderma and vitiligo.
24846220 2014 Misinitiation of intrathymic MART-1 transcription and biased TCR usage explain the high frequency of MART-1-specific T cells.
24394300 2014 Evaluation of the role of routine melan-A immunohistochemistry for exclusion of microinvasion in 120 cases of lentigo maligna.
23899062 2013 Marginal and joint distributions of S100, HMB-45, and Melan-A across a large series of cutaneous melanomas.
22925930 2012 Analysis of the processing of seven human tumor antigens by intermediate proteasomes.
22820661 2013 Melan A (A103) is not a marker of mesothelioma.
22768350 2012 Human macrophages and dendritic cells can equally present MART-1 antigen to CD8(+) T cells after phagocytosis of gamma-irradiated melanoma cells.
22688397 2013 Differences in tumor thickness between hematoxylin and eosin and Melan-A immunohistochemically stained primary cutaneous melanomas.
22529253 2012 Functional T cells targeting NY-ESO-1 or Melan-A are predictive for survival of patients with distant melanoma metastasis.
22291187 2012 HLA anchor optimization of the melan-A-HLA-A2 epitope within a long peptide is required for efficient cross-priming of human tumor-reactive T cells.
22190364 2011 Genome-wide meta-analysis identifies novel multiple sclerosis susceptibility loci.
22050092 2011 Aberrant Melan-A expression in atypical fibroxanthoma and undifferentiated pleomorphic sarcoma of the skin.
21993558 2012 MART-1- and gp100-expressing and -non-expressing melanoma cells are equally proliferative in tumors and clonogenic in vitro.
21760531 2011 Identification of an HLA-DPB1*0501 restricted Melan-A/MART-1 epitope recognized by CD4+ T lymphocytes: prevalence for immunotherapy in Asian populations.
21667026 Differential expression of Mart-1 in human uveal melanoma cells.
21610457 2011 Immunohistochemical double stains against Ki67/MART1 and HMB45/MITF: promising diagnostic tools in melanocytic lesions.
21362015 2011 An immunohistochemical comparison between MiTF and MART-1 with Azure blue counterstaining in the setting of solar lentigo and melanoma in situ.
21135695 2011 Molecular upstaging based on paraffin-embedded sentinel lymph nodes: ten-year follow-up confirms prognostic utility in melanoma patients.
20417641 2010 Structural basis for the presentation of tumor-associated MHC class II-restricted phosphopeptides to CD4+ T cells.
19861278 2009 [Detection of serum autoantibodies to melanocyte and correlation between melanoma antigen recognized by T-cells and vitiligo in children].
19717472 2009 The ocular albinism type 1 (OA1) G-protein-coupled receptor functions with MART-1 at early stages of melanogenesis to control melanosome identity and composition.
19384076 2009 Melan-a-positive "pseudomelanocytic nests": a pitfall in the histopathologic and immunohistochemical diagnosis of pigmented lesions on sun-damaged skin.
19320733 2009 Pigmentation-related genes and their implication in malignant melanoma susceptibility.
19317896 2009 Identification of a public CDR3 motif and a biased utilization of T-cell receptor V beta and J beta chains in HLA-A2/Melan-A-specific T-cell clonotypes of melanoma patients.
19050104 2009 Correlation of effector function with phenotype and cell division after in vitro differentiation of naive MART-1-specific CD8+ T cells.
18626310 2008 Skin layer-specific Melan-A expression during progression of human cutaneous melanoma: implications for diagnostic applications of the marker.
18494818 2008 Immunohistochemistry of pigmented actinic keratoses, actinic keratoses, melanomas in situ and solar lentigines with Melan-A.
18337837 2008 Lack of functionally active Melan-A(26-35)-specific T cells in the blood of HLA-A2+ vitiligo patients.
18181974 2008 Multimarker real-time reverse transcription-PCR for quantitative detection of melanoma-associated antigens: a novel possible staging method.
18097665 2008 A HLA-Cw*0701 restricted Melan-A/MART1 epitope presented by melanoma tumor cells to CD8+ tumor infiltrating lymphocytes.
18091323 2008 Comparison of immunohistochemical markers in the differential diagnosis of adrenocortical tumors: immunohistochemical analysis of adrenocortical tumors.
17768347 2007 Crystallization and preliminary X-ray structural studies of a Melan-A pMHC-TCR complex.
17719062 2007 Structures of MART-126/27-35 Peptide/HLA-A2 complexes reveal a remarkable disconnect between antigen structural homology and T cell recognition.
17227112 2007 Differential expression of melanocytic markers in myoid, lipomatous, and vascular components of renal angiomyolipomas.
17082590 2006 Melan-A/MART-1-specific CD4 T cells in melanoma patients: identification of new epitopes and ex vivo visualization of specific T cells by MHC class II tetramers.
17050671 2006 Role of the mitogen-activated protein kinase signaling pathway in the regulation of human melanocytic antigen expression.
16814609 2006 Identification of two Melan-A CD4+ T cell epitopes presented by frequently expressed MHC class II alleles.
15695812 2005 MART-1 is required for the function of the melanosomal matrix protein PMEL17/GP100 and the maturation of melanosomes.
15618925 2004 Expression of Melan-A and Ki-67 in desmoplastic melanoma and desmoplastic nevi.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15305155 2004 Expression of Melan-A/MART-1 in primary melanoma cell cultures has prognostic implication in metastatic melanoma patients.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14663359 2003 Melan A (A103) is expressed in adrenocortical neoplasms but not in renal cell and hepatocellular carcinomas.
12925214 2003 Cytotoxic T lymphocyte reactivity to gp100, MelanA/MART-1, and tyrosinase, in HLA-A2-positive vitiligo patients.
12819038 2003 MLANA/MART1 and SILV/PMEL17/GP100 are transcriptionally regulated by MITF in melanocytes and melanoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12444131 2002 Dominant TCR-alpha requirements for a self antigen recognition in humans.
12191019 2002 The melanocytic protein Melan-A/MART-1 has a subcellular localization distinct from typical melanosomal proteins.
12072203 2002 Newly established clear cell sarcoma (malignant melanoma of soft parts) cell line expressing melanoma-associated Melan-A antigen and overexpressing C-MYC oncogene.
11551907 2001 Subcellular localization of the melanoma-associated protein Melan-AMART-1 influences the processing of its HLA-A2-restricted epitope.
8170938 1994 Cloning of the gene coding for a shared human melanoma antigen recognized by autologous T cells infiltrating into tumor.
8006593 1994 A new gene coding for a differentiation antigen recognized by autologous cytolytic T lymphocytes on HLA-A2 melanomas.