Property Summary

NCBI Gene PubMed Count 20
PubMed Score 15.44
PubTator Score 13.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Multiple myeloma 1.800 3.4e-04
astrocytic glioma -1.600 2.3e-02
ependymoma -2.000 3.9e-02
oligodendroglioma -1.200 4.5e-02
psoriasis -1.200 5.6e-04
osteosarcoma -2.119 9.8e-04
atypical teratoid / rhabdoid tumor -1.700 2.4e-06
glioblastoma -1.300 8.1e-06
medulloblastoma -1.100 2.2e-06
medulloblastoma, large-cell -2.400 8.3e-06
lung cancer 1.500 6.4e-05
adult high grade glioma -1.100 1.0e-03
subependymal giant cell astrocytoma -1.558 2.6e-02
ulcerative colitis -1.100 5.5e-09
ovarian cancer 1.500 2.6e-03
dermatomyositis 1.300 4.2e-03

Gene RIF (8)

PMID Text
26817873 In combination testing, MKRN1 + HPV showed the highest sensitivity and specificity levels. The MKRN1 biomarker may be a useful adjunct in primary cervical cytology screening.
26183061 EGFR/PI3K/AKT-mediated ubiquitination and degradation of PTEN are dependent on the MKRN1 E3 ligase.
23104211 Results verified MKRN1 as an ubiquitin E3 ligase of p14ARF, it potentially regulates cellular aging and tumorigenesis in gastric cancer.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19846531 MKRN1 could induce WNV capsid protein ubiquitination and degradation in a proteasome-dependent manner
19604354 Makorin 1 is a novel SEREX antigen of esophageal squamous cell carcinoma
19536131 Data indicate that MKRN1 is a novel modulator of p53 and p21, preferentially leading cells to p53-dependent apoptosis by suppressing p21.
16785614 MKRN1 may represent a nuclear protein with multiple nuclear functions, including regulating RNA polymerase II-catalyzed transcription.

AA Sequence

MAEAATPGTTATTSGAGAAAATAAAASPTPIPTVTAPSLGAGGGGGGSDGSGGGWTKQVTCRYFMHGVCK      1 - 70
EGDNCRYSHDLSDSPYSVVCKYFQRGYCIYGDRCRYEHSKPLKQEEATATELTTKSSLAASSSLSSIVGP     71 - 140
LVEMNTGEAESRNSNFATVGAGSEDWVNAIEFVPGQPYCGRTAPSCTEAPLQGSVTKEESEKEQTAVETK    141 - 210
KQLCPYAAVGECRYGENCVYLHGDSCDMCGLQVLHPMDAAQRSQHIKSCIEAHEKDMELSFAVQRSKDMV    211 - 280
CGICMEVVYEKANPSERRFGILSNCNHTYCLKCIRKWRSAKQFESKIIKSCPECRITSNFVIPSEYWVEE    281 - 350
KEEKQKLILKYKEAMSNKACRYFDEGRGSCPFGGNCFYKHAYPDGRREEPQRQKVGTSSRYRAQRRNHFW    351 - 420
ELIEERENSNPFDNDEEEVVTFELGEMLLMLLAAGGDDELTDSEDEWDLFHDELEDFYDLDL            421 - 482
//

Text Mined References (24)

PMID Year Title
26817873 2016 Makorin Ring Finger Protein 1 as Adjunctive Marker in Liquid-based Cervical Cytology.
26183061 2015 PI3K/AKT activation induces PTEN ubiquitination and destabilization accelerating tumourigenesis.
23104211 2012 Acceleration of gastric tumorigenesis through MKRN1-mediated posttranslational regulation of p14ARF.
22864571 2012 Ubiquitination and degradation of the FADD adaptor protein regulate death receptor-mediated apoptosis and necroptosis.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21172006 2010 The vertebrate makorin ubiquitin ligase gene family has been shaped by large-scale duplication and retroposition from an ancestral gonad-specific, maternal-effect gene.
20473778 2010 Differentiation linked regulation of telomerase activity by Makorin-1.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19846531 2010 MKRN1 induces degradation of West Nile virus capsid protein by functioning as an E3 ligase.
19604354 2009 Identification of Makorin 1 as a novel SEREX antigen of esophageal squamous cell carcinoma.
19536131 2009 Differential regulation of p53 and p21 by MKRN1 E3 ligase controls cell cycle arrest and apoptosis.
19178923 2009 Interaction of the replication proteins and the capsid protein of porcine circovirus type 1 and 2 with host proteins.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16785614 2006 Makorin RING finger protein 1 (MKRN1) has negative and positive effects on RNA polymerase II-dependent transcription.
15805468 2005 Ubiquitin ligase MKRN1 modulates telomere length homeostasis through a proteolysis of hTERT.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
10843807 2000 The ancient source of a distinct gene family encoding proteins featuring RING and C(3)H zinc-finger motifs with abundant expression in developing brain and nervous system.