Property Summary

NCBI Gene PubMed Count 18
PubMed Score 14.15
PubTator Score 5.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma 2.700 2.0e-02
ependymoma 2.900 4.2e-03
oligodendroglioma 2.500 3.4e-03
glioblastoma multiforme 1.200 3.4e-19
osteosarcoma -2.265 1.0e-05
medulloblastoma, large-cell -1.300 8.6e-05
acute quadriplegic myopathy 1.492 1.1e-06
primary pancreatic ductal adenocarcinoma 1.166 3.6e-03
tuberculosis and treatment for 3 months -1.600 6.7e-06
group 3 medulloblastoma 1.400 1.8e-02
pilocytic astrocytoma 1.100 1.5e-03
Pick disease 1.300 1.3e-03
ovarian cancer -1.900 3.5e-12
pancreatic cancer 1.100 6.7e-03

Gene RIF (3)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18710924 These novel findings identify a role for muskelin-RanBP9 complex in pathways that integrate cell morphology regulation and nucleocytoplasmic communication.
17467196 RanBPM, ARMC8alpha, ARMC8beta, Muskelin, p48EMLP, and p44CTLH form complexes in cells

AA Sequence

MAAGGAVAAAPECRLLPYALHKWSSFSSTYLPENILVDKPNDQSSRWSSESNYPPQYLILKLERPAIVQN      1 - 70
ITFGKYEKTHVCNLKKFKVFGGMNEENMTELLSSGLKNDYNKETFTLKHKIDEQMFPCRFIKIVPLLSWG     71 - 140
PSFNFSIWYVELSGIDDPDIVQPCLNWYSKYREQEAIRLCLKHFRQHNYTEAFESLQKKTKIALEHPMLT    141 - 210
DIHDKLVLKGDFDACEELIEKAVNDGLFNQYISQQEYKPRWSQIIPKSTKGDGEDNRPGMRGGHQMVIDV    211 - 280
QTETVYLFGGWDGTQDLADFWAYSVKENQWTCISRDTEKENGPSARSCHKMCIDIQRRQIYTLGRYLDSS    281 - 350
VRNSKSLKSDFYRYDIDTNTWMLLSEDTAADGGPKLVFDHQMCMDSEKHMIYTFGGRILTCNGSVDDSRA    351 - 420
SEPQFSGLFAFNCQCQTWKLLREDSCNAGPEDIQSRIGHCMLFHSKNRCLYVFGGQRSKTYLNDFFSYDV    421 - 490
DSDHVDIISDGTKKDSGMVPMTGFTQRATIDPELNEIHVLSGLSKDKEKREENVRNSFWIYDIVRNSWSC    491 - 560
VYKNDQAAKDNPTKSLQEEEPCPRFAHQLVYDELHKVHYLFGGNPGKSCSPKMRLDDFWSLKLCRPSKDY    561 - 630
LLRHCKYLIRKHRFEEKAQVDPLSALKYLQNDLYITVDHSDPEETKEFQLLASALFKSGSDFTALGFSDV    631 - 700
DHTYAQRTQLFDTLVNFFPDSMTPPKGNLVDLITL                                       701 - 735
//

Text Mined References (23)

PMID Year Title
25208829 2014 Genome-wide association study of vitamin D levels in children: replication in the Western Australian Pregnancy Cohort (Raine) study.
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
23829686 2013 Rank-based genome-wide analysis reveals the association of ryanodine receptor-2 gene variants with childhood asthma among human populations.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20038947 2011 Novel loci for major depression identified by genome-wide association study of Sequenced Treatment Alternatives to Relieve Depression and meta-analysis of three studies.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18710924 2008 Novel role of the muskelin-RanBP9 complex as a nucleocytoplasmic mediator of cell morphology regulation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17467196 2007 RanBPM, Muskelin, p48EMLP, p44CTLH, and the armadillo-repeat proteins ARMC8alpha and ARMC8beta are components of the CTLH complex.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15084145 2004 Molecular analysis of muskelin identifies a conserved discoidin-like domain that contributes to protein self-association.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12559565 2003 A novel nuclear protein, Twa1, and Muskelin comprise a complex with RanBPM.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11006128 2000 Receptor isoform-specific interaction of prostaglandin EP3 receptor with muskelin.
10640805 1999 cDNA cloning of human muskelin and localisation of the muskelin (MKLN1) gene to human chromosome 7q32 and mouse chromosome 6 B1/B2 by physical mapping and FISH.
9724633 1998 Muskelin, a novel intracellular mediator of cell adhesive and cytoskeletal responses to thrombospondin-1.