Property Summary

NCBI Gene PubMed Count 47
PubMed Score 127.46
PubTator Score 64.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Polydactyly 107
Retinitis Pigmentosa 226
Obesity 678
Hydronephrosis 89
Abnormality of cardiovascular system morphology 23
Anus, Imperforate 46
Aphakia, congenital primary 5
Asthma 385
Atresia of vagina 10
Autosomal recessive predisposition 1442
BILIARY TRACT ABNORMALITY 16
Biliary Tract Diseases 16
Brachydactyly 156
Broad feet 19
Cerebellar Ataxia 304
Cognitive delay 608
Congenital hypoplasia of lung 48
Congenital hypoplasia of ovary 30
Congenital hypoplasia of penis 176
Cryptorchidism 296
Cystic kidney 30
Delayed speech and language development 112
Dilatation of ureter 15
Dull intelligence 645
Edema 81
Edema of lower extremity 3
Electroretinogram abnormal 95
Fibrosis, Liver 32
Gait imbalance 17
Global developmental delay 608
High, narrow palate 32
Hip Dislocation, Congenital 48
Hirschsprung Disease 31
Hirsutism 47
Hydrometrocolpos 1
Hypertensive disease 292
Hypodontia 81
Hypogonadism 173
Hypoplastic feet 66
Hypoplastic ovary 30
Hypospadias, balanic 2
Inadequate arch length for tooth size 45
Increase in blood pressure 119
Intellectual disability 1016
Kaufman-McKusick syndrome 1
Language Delay 112
Left Ventricular Hypertrophy 47
Leg edema 3
Low intelligence 645
Megacolon 29
Mental Retardation 645
Mental and motor retardation 608
Mental deficiency 645
Mesoaxial hand polydactyly 4
Multicystic Dysplastic Kidney 52
Nephrogenic Diabetes Insipidus 16
Nystagmus 317
Penile hypospadias 106
Polycystic Kidney - body part 18
Polycystic Kidney Diseases 20
Polydactyly of toes 12
Poor coordination 11
Poor school performance 645
Radially deviated fingers 38
Reactive airway disease 21
Rectovaginal Fistula 5
Renal cyst 30
Retinal Degeneration 106
Short stature 531
Small genitalia 13
Small testicle 75
Specific learning disability 47
Speech Delay 112
Speech Disorders 58
Speech impairment 112
Strabismus 270
Syndactyly 88
Tooth Crowding 45
Tooth mass arch size discrepancy 45
Tooth size discrepancy 45
Transverse vaginal septum 2
Ulnar polydactyly of fingers 47
Urogenital sinus anomaly 15
Uroureter 15
Vesicovaginal Fistula 2
diabetes mellitus 1728
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count
Bardet-Biedl syndrome 51

Expression

  Differential Expression (15)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.600 1.5e-05
gastric cancer 1.200 1.7e-03
glioblastoma -1.400 2.2e-04
hepatocellular carcinoma 1.500 7.3e-07
lung carcinoma 1.100 6.0e-14
medulloblastoma -1.100 1.5e-04
medulloblastoma, large-cell -1.400 4.1e-06
osteosarcoma -1.162 1.1e-02
ovarian cancer -1.100 3.9e-05
pancreatic cancer 1.500 9.0e-04
pancreatic carcinoma 1.500 9.0e-04
pancreatic ductal adenocarcinoma liver m... -2.054 4.7e-02
Pick disease -1.200 2.9e-04
psoriasis 1.100 3.8e-12
tuberculosis and treatment for 6 months -1.200 8.8e-04

Gene RIF (20)

AA Sequence

MSRLEAKKPSLCKSEPLTTERVRTTLSVLKRIVTSCYGPSGRLKQLHNGFGGYVCTTSQSSALLSHLLVT      1 - 70
HPILKILTASIQNHVSSFSDCGLFTAILCCNLIENVQRLGLTPTTVIRLNKHLLSLCISYLKSETCGCRI     71 - 140
PVDFSSTQILLCLVRSILTSKPACMLTRKETEHVSALILRAFLLTIPENAEGHIILGKSLIVPLKGQRVI    141 - 210
DSTVLPGILIEMSEVQLMRLLPIKKSTALKVALFCTTLSGDTSDTGEGTVVVSYGVSLENAVLDQLLNLG    211 - 280
RQLISDHVDLVLCQKVIHPSLKQFLNMHRIIAIDRIGVTLMEPLTKMTGTQPIGSLGSICPNSYGSVKDV    281 - 350
CTAKFGSKHFFHLIPNEATICSLLLCNRNDTAWDELKLTCQTALHVLQLTLKEPWALLGGGCTETHLAAY    351 - 420
IRHKTHNDPESILKDDECTQTELQLIAEAFCSALESVVGSLEHDGGEILTDMKYGHLWSVQADSPCVANW    421 - 490
PDLLSQCGCGLYNSQEELNWSFLRSTRRPFVPQSCLPHEAVGSASNLTLDCLTAKLSGLQVAVETANLIL    491 - 560
DLSYVIEDKN                                                                561 - 570
//

Text Mined References (53)

PMID Year Title