Property Summary

NCBI Gene PubMed Count 226
PubMed Score 1162.13
PubTator Score 449.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Waardenburg's syndrome 16 6.837 3.4

Expression

  Differential Expression (16)

Disease log2 FC p
Rheumatoid Arthritis 1.100 1.6e-02
malignant mesothelioma -1.500 6.7e-06
osteosarcoma 1.212 3.2e-03
group 4 medulloblastoma -1.700 3.8e-04
medulloblastoma, large-cell -1.900 1.7e-05
non-small cell lung cancer -1.524 7.2e-19
intraductal papillary-mucinous neoplasm ... 1.100 1.6e-02
lung cancer -2.100 1.4e-05
active Crohn's disease 1.608 2.4e-02
fibroadenoma -1.900 5.7e-04
cystic fibrosis -1.200 3.2e-04
lung carcinoma -1.900 1.3e-27
ductal carcinoma in situ -1.200 4.7e-03
invasive ductal carcinoma -1.800 2.9e-04
ulcerative colitis 1.200 2.1e-04
ovarian cancer -2.400 7.5e-06

Protein-protein Interaction (9)

MLP Assay (20)

AID Type Active / Inconclusive / Inactive Description
488899 screening 2767 / 163 / 328648 MITF Measured in Cell-Based System Using Plate Reader - 2084-01_Inhibitor_SinglePoint_HTS_Activity
488944 summary 1 / 0 / 0 Summary of Broad Institute MLPCN Identification of MITF Inhibitors Project
493073 confirmatory 809 / 0 / 432 MITF Measured in Cell-Based System Using Plate Reader - 2084-01_Inhibitor_DoseNoFile_CherryPick_Activity_Set3
493102 confirmatory 809 / 0 / 432 MITF Measured in Cell-Based System Using Plate Reader - 2084-01_Inhibitor_DoseNoFile_CherryPick_Activity_Set4
493177 confirmatory 809 / 0 / 432 MITF Measured in Cell-Based System Using Plate Reader - 2084-01_Inhibitor_DoseNoFile_CherryPick_Activity_Set2
493191 confirmatory 333 / 0 / 947 MITF Orthogonal Assay: MALME3 CTG Assay Measured in Cell-Based System Using Plate Reader - 2084-04_Inhibitor_Dose_CherryPick_Activity
493240 confirmatory 274 / 1 / 1005 MITF Orthogonal Assay: SK-MEL-5 CTG Assay Measured in Cell-Based System Using Plate Reader - 2084-02_Inhibitor_Dose_CherryPick_Activity_Set3
540339 confirmatory 28 / 0 / 1 MITF Orthogonal Assay: MALME3 CTG Assay Measured in Cell-Based System Using Plate Reader - 2084-04_Inhibitor_Dose_DryPowder_Activity
540346 confirmatory 266 / 0 / 1014 MITF: Counter assay: A375 proliferation Measured in Cell-Based System Using Plate Reader - 2084-03_Inhibitor_Dose_DryPowder_Activity
624259 confirmatory 64 / 0 / 6 MITF Measured in Cell-Based System Using Plate Reader - 2084-01_Inhibitor_Dose_DryPowder_Activity_Set3
More...

Gene RIF (184)

PMID Text
26962685 A concomitant AURKA/BRAF and AURKA/MEK targeting overcame MAPK signaling activation-associated resistance signature in BRAF- and NRAS-mutated melanomas, respectively, and elicited heightened anti-proliferative activity and apoptotic cell death.
26927636 SOX5 has a strong inhibitory effect on MITF expression and seems to have a decisive clinical impact on melanoma during tumor progression.
26773496 Here we show that MITF-A mRNA is predominantly expressed in all three human liver cancer cell lines examined.
26663054 Data suggest that the heterozygous deletion mutation c.649_651delAGA in exon 7 of the microphthalmia-associated transcription factor (MITF) gene probably underlies the disease in the first family.
26663053 Data show that mutant microphthalmia-associated transcription factor (MITF) with loss of localization signals (NLS) has failed to transactivate the transcriptional activities of target gene tyrosinase (TYR), which can cause Waardenburg syndrome.
26650189 In addition to melanoma risk, MITF p.E318K is associated with a high nevi count and could play a role in fast-growing melanomas.
26580798 LEF-1 and MITF regulate tyrosinase gene transcription in vitro via binding to its promoter.
26530832 A reciprocal antagonism between the MITF and c-Jun interconnects inflammation-induced dedifferentiation with pro-inflammatory cytokine responsiveness of melanoma cells favouring myeloid cell recruitment.
26522736 Results show that Mitf, probably including Mitf-M, is expressed in the mitral cells and tufted cells that transmit the information derived from olfactory sensory neurons to the olfactory cortex.
26512583 mutation associated with single-side deafness
26414466 Studies indicate that gene rearrangement of the microphthalmia transcription factor (MiT) family may be helpful in diagnostically challenging cases.
26317170 expression of the molecular marker Mitf in primary cutaneous melanomas is a useful tool in assessing lymph node status.
26301891 an MITF-CEACAM1 axis is suggested as a potential determinant of melanoma progression.
26252099 Loss of entire MITF gene is associated with Tietz/Waardenburg type II a syndrome.
26236014 direct contact of melanoma cells with the remote epidermal layer triggers vertical invasion via Notch signaling activation, the latter serving to inhibit MITF function.
25975176 found the MITF variant E318K neither in melanoma patients (either familial, including pancreatic cancer, or sporadic) nor in controls, in a total of 702 individuals genotyped;MITF E318K might not be considered a contributor to melanoma risk in this geographical region
25889792 The transcription factor MITF is a critical regulator of GPNMB expression in dendritic cells.
25866058 MITF expression may affect the melanoma phenotype with consequences on the survival, invasion and metastasis of melanoma cells, and we discuss the research challenges. Review.
25865119 Melanoma reprogramming involves thousands of genomic regulatory regions underlying the proliferative and invasive states, identifying SOX10/MITF and AP-1/TEAD as regulators, respectively.
25853464 our results indicate that MITF-M downregulation by inflammatory stimuli might be partly due to miR-155 upregulation. This could represent a novel mechanism of melanoma immune escape in an inflammatory microenvironment.
25803486 MITF-BRG1 interplay thus plays an essential role in transcription regulation in melanoma.
25789707 MITF modulates drug resistance through EGFR signaling in cutaneous malignant melanoma patients.
25705847 MITF protein is a key regulator of melanocyte development and a lineage-specific oncogene is melanoma development.
25648896 The teneurin-1 intracellular domain binds HINT1, thus switching on MITF-dependent transcription of GPNMB.
25605940 show that the MITF protein was stabilized by Wnt signaling, through the novel C-terminal GSK3 phosphorylations identified here. MITF stabilization caused an increase in multivesicular body biosynthesis, which in turn increased Wnt signaling
25502142 Low MITF/AXL ratio predicts early resistance to multiple targeted drugs in melanoma.
25447045 MITF-regulated PEDF has a role in melanoma progression
25433395 Studies indicate that MITF (microphthalmia-associated transcription factor) activity is modulated by its upstream activators and suppressors operating on transcriptional, post-transcriptional and post-translational levels.
25414259 MicroRNA-340-mediated degradation of MITF mRNA is inhibited by CRD-BP.
25238448 Report positive MITF staining in atypical fibroxanthoma.
25141921 PTN decreased melanogenesis, probably through MITF degradation via Erk1/2 activation in melanocytes.
25065405 the activation of reactive oxygen species-ERK pathway by mitochondrial fission induced phosphorylation of serine73 on MITF accelerating its proteasomal degradation.
25030625 these results identify PEDF as a novel transcriptional target of MITF and support a relevant functional role for the MITF-PEDF axis in the biology of melanoma.
25008112 confirmed the requirement of MITF for normal RPE development and identified a novel role for MITF in optic vesicle proliferation prior to the neural retina versus retinal pigment epithelium cell fate decision.
24862846 miR-330-5p is a potent negative regulator of TYR, but not of MITF, in pigmented melanoma cells and normal melanocytes
24824743 MicroRNA-218 inhibits melanogenesis by directly suppressing microphthalmia-associated transcription factor expression.
24789918 Our data identify Gpnmb as a novel marker for obesity-induced adipose tissue macrophage infiltration and potentiator of interleukin-4 responses and point toward a crucial role for MITF in driving part of the adipose tissue macrophage phenotype.
24771846 Study shows that downregulation of MITF and upregulation of NF-kappaB expression may play a role in melanoma resistance to MAPK pathway inhibitors.
24767713 Data indicate no statistically significant differences in the prevalence of the microphthalmia-associated transcription factor (MITF) E318K and V320I variants among cases and controls.
24733089 The reduced MITF level in monolayers might be partially explained by suppression of the Wnt/beta-catenin pathway, and DKK1, a secreted inhibitor of this pathway, was highly up-regulated in monolayers in comparison to melanospheres and original tumors.
24706302 The probability of melanoma would be 92% if the MITF test was positive.
24406078 Carriage of MITF E318K was associated with melanoma more strongly in people with dark hair than fair hair and in those with no moles than some or many moles. There was no evidence of interaction between MC1R 'red hair variants' and MITF E318K.
24390218 Identify FN1(high)MITF(low) cell type in melanoma associated with ischemic necrosis, and propose these cells reside at the crossroad of the epithelial-to-mesenchymal transition and stem-like cell induction, plausibly triggered by the hypoxic environment.
24379252 mutations of MITF, SNAI2 and SOX10 genes are observed in Waardenburg syndrome type II.(review)
24335901 miR-675 derived from keratinocytes could be involved in H19-stimulated melanogenesis using MITF as a target of miR-675
24290354 MITF has an important oncogenic function in tumorigenesis of multiple tissues/melanocytes and kidney cells (Review)
24287867 c-Kit/MITF-M signalling is one of the key pathways for hair depigmentation in juvenile poliosis.
24226203 analysis of the alternatively spliced MITF exon 2 variant
24194866 MITF mutations are relatively common among Chinese Waardenburg syndrome type II patients.
24107097 cAMP-PKA-CREB-activated microphthalmia-associated transcription factor and tyrosinase expression is inhibited by the novel novel adamantyl benzylbenzamide derivative, AP736
24039954 The study shows that MITF-correlated miR-211 expression levels are mostly but not always reduced in a panel of 11 melanoma cell lines and in primary and metastatic melanoma compared to normal melanocytes and nevi, respectively.
23962556 Data indicate that miR-101 overexpression downregulates microphthalmia-associated transcription factor (MITF) and enhancer of zeste homolog 2 (EZH2) protein in melanoma cells.
23923085 our experience shows that MITF can be a valuable adjunct in the diagnosis of metastatic tumors that are suspicious for melanoma but negative for other melanoma markers
23921446 Results suggest that MITF, and several MITF-regulated factors, are associated with resistance to chemotherapy in melanoma and that different MITF targets can be of importance for different drugs.
23802662 MITF, PTEN, and CDKN2A germline mutations associated with multiple primary melanomas.
23787126 characterization of DNA-binding and transcription activation properties of MITF mutations found in Waardenburg syndrome type 2A (WS2A), Tietz syndrome (TS) and melanoma; most of the WS2A and TS MITF mutations fail to bind DNA but mutations in melanomas showed normal DNA-binding providing insight into how mutations in a single gene can lead to different phenotypes
23782678 Both MITF-1 and SOX10 can be used to differentiate melanoma in situ from actinic keratosis with melanocytic hyperplasia
23774529 A high incidence of amelanotic melanomas was found within the group, with three of the five melanomas from one patient suggesting a genetic interaction between the MITF E318K allele and an MC1R homozygous red hair color (RHC) variant genotype.
23728343 these results identify AMPK as an important regulator for the maintenance of MITF protein levels in melanocytic cells.
23480510 BRG1 regulates ML-IAP expression by cooperating with MITF to promote transcriptionally permissive chromatin structure on the ML-IAP promoter.
23477830 Melanomas with activation of the BRAF/MAPK pathway have suppressed levels of MITF and PGC1alpha and decreased oxidative metabolism
23349796 Data suggests that loss of BRG1-based SWI/SNF complexes negatively affects survival pathways beyond the MITF cascade.
23275444 The new HIF2alpha partners microphthalmia-associated transcription factor, SOX10, and AP2alpha, which are master actors of melanoma development, were confirmed via co-immunoprecipitation experiments.
23223141 Expressions of microphthalmia-associated transcription factor (MITF), a master transcriptional regulator of melanogenesis, and cAMP-responsive element-binding activation were not affected by LXR activation.
23201126 Inhibition of PGC-1a and PGC-1b blocks the alpha-MSH-mediated induction of MITF and melanogenic genes.
23167872 These findings further support MITF as a medium-penetrance melanoma susceptibility gene.
23098757 Results suggest that haploinsufficiency may be the underlying mechanism for the mild phenotypes of WS2 caused by two mutations in MITF.
22898827 The results suggested that the miRNAs may be involved in MITF regulation of TYR, TYRP1 and TYRP2, which provides a new clue for understanding the role of miRNAs in melanocyte dysfunctional disease.
22848661 deletions and point mutations within the MITF and SOX10 regulatory elements in 28 yet unexplained Waardenburg syndrome type 2 cases
22848417 miR-182, a p53 dependent miRNA, suppressed the expression of MITF, BCL2, cyclin D2 and functioned as a potent tumor suppressor in uveal melanoma cells.
22833560 Data show a combination of only five genes (-BCL6, T (BRACHYURY), c-MYC, MITF and BAF60C (SMARCD3) rapidly and efficiently convert postnatal chorion and decidual cells into chondrocytes.
22668579 Report MITF as immunohistochemical marker for epidermial melanocytes in atypical intraepidermal melanocytic proliferations.
22594792 BCSC-1 binds to Sox10, which down regulates MITF, and results in a switch of melanoma cells from a proliferative to a migratory phenotype.
22571403 results suggest that SOX2 is required for the endogenous levels of MITF in hESC-NC and normal human melanocytes in vitro
22523078 MITF is a key regulator of RPE differentiation that was also down-regulated in dedifferentiated hfRPE cells. MITF knockdown decreased miR-204/211 expression and caused hfRPE dedifferentiation.
22496449 identified a GLI2 binding site within the -334/-296 region of the M-MITF promoter, critical for GLI2-driven transcriptional repression
22441367 expression of MiTF may be a reliable marker for distinguishing cellular neurothekeoma from histiocytoid-predominant plexiform fibrohistiocytic tumor
22320238 report of a rare Waardenburg syndrome simplex family in which a pair of WS parents gave birth to a child with double heterozygous mutations of MITF and PAX3; compared to his parents who carried a single mutation in either MITF or PAX3, the child showed increased penetrance of pigmentary defects
22258527 Novel and recurrent non-truncating mutations of the MITF basic domain: genotypic and phenotypic variations in Waardenburg and Tietz syndromes
22196401 A novel compound heterozygous mutation, c.[742_743delAAinsT;746_747delCA] in MITF exon 8 was the key genetic reason for Waardenburg syndrome type II in the studied family.
22131883 MITF-M may be a prerequisite for the pigmented cell lineage-specific function of HERV-K LTR, leading to the high-level expression in malignant melanomas.
22115973 MITF acts through PEDF to inhibit RPE cell migration and to play a significant role in regulating RPE cellular function.
22080950 These data indicate that MITF is a melanoma-predisposition gene
22012259 identify a germline missense substitution in MITF (Mi-E318K) that occurred at a significantly higher frequency in genetically enriched patients affected with melanoma, renal cell carcinoma or both cancers, when compared with controls
21996743 these results reveal a hypoxia-HIF1alpha-BHLHB2-MITF cascade controlling the phenotypic plasticity in melanoma cells and favouring metastasis development.
21981993 Inhibition of CRD-BP decreases MITF expression. Its reintroduction partially compensates for the absence of CRD-BP. Melanoma resistance to chemotherapy due to CRD-BP is mediated, at least in part, by MITF.
21949374 MITF expression is potently reduced under hypoxic conditions in primary melanocytes and melanoma and clear cell sarcoma cells through hypoxia inducible factor 1 (HIF1)-mediated induction of DEC1.
21887372 mechanisms by which c-KIT signaling regulates Mitf, with implications for understanding both melanocyte development and melanoma
21873430 The E-box binding factors Max/Mnt, MITF, and USF1 act coordinately with FoxO to regulate expression of proapoptotic and cell cycle control genes by phosphatidylinositol 3-kinase/Akt/glycogen synthase kinase 3 signaling.
21811243 Through deubiquitination, USP13 stabilizes and upregulates MITF protein levels.
21801332 These findings thus identify GLI2 as a critical transcription factor antagonizing M-MITF function to promote melanoma cell phenotypic plasticity and invasive behavior.
21797920 MiTF is a superior marker for quantification of melanocytes in the evaluation of subtle intraepidermal melanocytic proliferations and in the differential diagnosis of solar lentigo.
21796150 Axl-positive melanomas did not express microphthalmia transcription factor (MITF) and melanocyte differentiation antigens such as MART-1 and gp100 and possessed a greater in vitro invasive potential compared with Axl-negative ones.
21771814 find reduced levels of Mitf activity using an mitfa temperature-sensitive line results in a dramatic increase in differentiated melanocyte cell division
21610457 The HMB45/MITF stains may serve as adjuncts to predict malignancy of melanocytic lesions.
21577209 the cell-type-specific presence of MITF in melanoma affects beta-catenin's pro-invasive properties otherwise active in colon or liver cancer.
21438779 demonstrated through linkage, genomic sequence analysis, and expression studies a novel splice mutation in MITF that was previously unrecognized in a large family with Waardenbrug syndrome.
21362015 MiTF is as effective as MART-1/Azure blue in identifying melanocytes in the context of solar lentigo or melanoma in situ
21358674 links BRN2 as an activator and MITF as a repressor of the NOTCH pathway in melanoma cells. Loss of the BRN2-MITF axis in antisense-ablated cell lines decreased the melanoma sphere-forming capability and cell adhesion
21326905 Studies indicate that MITF directly regulates the transcription of genes involved in pigmentation, which are selective to the melanocyte lineage.
21324898 Data demonstrate that Mitf and HDAC7 interact in RAW 264 cells and osteoclasts. The transcriptional activity of Mitf is repressed by HDAC7.
21273305 A novel regulatory pathway between 2 critical mast cell factors, KIT and MITF, mediated by miRNAs; dysregulation of this pathway may contribute to abnormal mast cell proliferation and malignant mast cell diseases.
21203491 MITF is downregulated by ATF2 in the skin of Atf2-/- mice, in primary human melanocytes, and in melanoma cell lines.
21164369 PAX3 and MITF are expressed in human melanoma cell lines, but function independently to enhance the survival of melanoma cells
21070662 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20973930 The myriad consequences of ultraviolet exposure for skin homeostasis is reviewed highlighting the diverse pathways activated by this ultraviolet radiation, including induction of MITF.
20952536 Studies identified phosphodiesterase 4D3 as a direct target of the MSH/cAMP/MITF pathway.
20807369 Seven decades of Mitf research have led to many insights about development, function, degeneration, and malignancies of a number of specific cell types.
20801516 Observational study of genetic testing. (HuGE Navigator)
20701798 data suggest that MiTF mediates a survival signal linking Erk1/2 activation and p21 WAF1/CIP1 regulation via phosphorylation on serine 73, which facilitates cell cycle arrest
20644734 MiR-148 was shown to affect Mitf mRNA expression in melanoma cells through a conserved binding site in the 3'UTR sequence of mouse and human Mitf.
20573688 Study show that MiTF-CX is a cell type-specific physiological repressor of IL-8 expression in cervical stromal cells that acts via a cognate binding site within the human IL-8 promoter.
20550935 Targeted knockout of DICER is lethal to melanocytes, at least partly via DICER-dependent processing of the pre-miRNA-17 approximately 92 cluster thus targeting BIM, a known proapoptotic regulator of melanocyte survival.
20530484 SOX9, through interaction with microphthalmia-associated transcription factor (MITF) and OTX2, regulates BEST1 expression in the retinal pigment epithelium.
20514666 MITF immunohistochemistry is dependable in frozen sections, and may prove to be useful in Mohs micrographic surgery
20513998 MITF might play a role in regulating the transcription of tryptase gene in human mast cells
20485200 These findings suggest that MITF does not play a critical role in mast cell development in humans.
20482673 TRPM1 mRNA expression is specific for melanocytes and strongly associated with MITF and tyrosinase expression, the latter implicating a mature melanocyte phenotype
20478267 Seven new mutations in PAX3, MITF, and SOX10 genes in 11 families with type I or type II Waardenburg syndrome were identified.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20201954 MITF is an essential regulator not only for melanocyte development, proliferation and survival, but also for the expression of enzymes and structural proteins ensuring the production of melanin. Review.
20163701 A novel splice variant of MITF-M,named MITF-Mdel, was id'd and contains two in frame deletions. MITF-Mdel was widely expressed in melanocytes, melanoma cell lines and tissues, but almost undetectable in non-melanoma cell lines or PBMC from healthy donors.
20099279 large amounts of biologically active IL-1alpha or IL-1beta secreted by two melanoma cell lines that did not express MITF.
20083088 Together these results demonstrate the essential role of SWI/SNF for expression of MITF and suggest that SWI/SNF may be a promissing target in melanoma therapy.
19895547 The results suggest that differential expression of the Mitf 6a/b isoforms may represent an additional mechanism for regulating Mitf function and melanoma biology.
19805117 Results identified the receptor protein tyrosine kinase TYRO3 as an upstream regulator of MITF expression by a genome-wide gain-of-function cDNA screen.
19784067 Data suggest that heterogeneous SWI/SNF complexes composed of either the BRG1 or BRM subunit promote expression of distinct and overlapping MITF target genes.
19659611 MITF may be an important molecular target for human melanoma
19496784 Low expression of microphthalmia-associated transcription factor, a potential molecular target for interferon-alpha susceptibility, is associated with metastasis in renal cell carcinoma.
19464596 MITF's role in overlapping networks of transcriptional activation & repression, pigment production & cell survival, proliferation, and cell cycle arrest, especially in melanoma are reviewed. Review.
19422606 altered MITF function during melanomagenesis can be achieved by MITF amplification, MITF single base substitutions or by mutation of its regulator SOX10.
19422606 Observational study of gene-disease association. (HuGE Navigator)
19320733 Observational study of gene-disease association. (HuGE Navigator)
19188590 expression of miR-182 increases with progression from primary to metastatic melanoma and inversely correlates with FOXO3 and microphthalmia-associated transcription factor levels
18971960 MiTF regulates cellular response to reactive oxygen species by regulation of APE-1, and this may provide a mechanism of how MiTF is involved in melanoma carcinogenesis
18829533 Brn-2 regulates invasiveness and directly represses Mitf expression.
18636124 Observational study of gene-disease association. (HuGE Navigator)
18628967 BRAF regulates melanoma proliferation through the lineage specific factor MITF
18595666 study identified a novel MITF mutation of IVS4 -1G --> C in a Japanese family with Waardenburg syndrome type II
18478240 activation of p38 MAPK plays an important role in LPS-induced melanogenesis by up-regulating MITF and tyrosinase expression
18457359 plays a predominant role in regulation of melanogenesis.
18451137 MITF is a major transcriptional regulator of melanoma inhibitor of apoptosis expression in melanomas.
18424413 Data report a three-generation Chinese family with a point mutation in the MITF gene causing Waardenburg syndrome type 2.
18316599 expression of mature miR-137 in melanoma cell lines down-regulates MITF expression
18284417 a novel MITF isoform, MITF-CM, which possesses a unique amino terminus was identified.
18281284 These results show that RAB27A is a new direct transcriptional target of MITF and link MITF to melanosome transport, another key parameter of melanocyte differentiation and skin pigmentation.
18039926 link between microphthalmia-associated transcription factor haploinsufficiency and endothelin signaling
17975146 Microphthalmia-associated transcription factor gene amplification in metastatic melanoma may have a role in patient survival
17627390 Detection of both partial and whole gene deletions of MITF increase mutation detection in Waardenburg syndrome.
17516926 analysis of the Mitf gene reveals novel conserved domains in human, mouse and Drosophila
17464203 Observational study of gene-disease association. (HuGE Navigator)
17250547 MITF evokes transcription of a paradigmatic MITF target tyrosinase and show that the adenoviral E1A protein represses the MITF-driven transcription in these cells.
17182868 findings show that in melanomas invasiveness can be regulated epigenetically by Mitf, via regulation of the DIAPH1 gene; Mitf, via regulation of Dia1, can both inhibit invasiveness & promote proliferation
17159916 Of special interest was the rapid decrease in expression of MITF in melanocytes treated with DKK1, which is concurrent with the decreased activities of beta-catenin and of glucose-synthase kinase 3beta.
16766266 MITF and TFE3 reciprocally rescue one another in lines derived from CCS or pediatric renal carcinoma.
16586042 Tacrolimus or cyclosporine A act on human osteoclast precursors in rheumatoid arthritis patients by targeting the calcineurin-dependent NFAT pathway and activation pathway for c-Jun or MITF.
16524430 Sphingosylphosphorylcholine reduces melanin synthesis via MITF downregulation.
16510564 The transcription factor MITF is an amplified oncogene in melanoma that is critical for anchoring lineage dependence and malignant character.
16489066 Mitf detection in blood can indicate subclinical metastatic disease and predict treatment outcome in melanoma patients.
16455654 c-Met expression is regulated by Mitf in the melanocyte lineage
16420247 The results of this study demonstrate a role for glutamate in MiTF regulation that may have implications in melanocyte associated disorders.
16411896 MITF, specifically MITF-M, is a key transcription factor for protein kinase C-beta (PKC-beta), linking the PKC- and cAMP-dependent pathways in regulation of melanogenesis
16140982 identified MITF as a new substrate of caspases and we characterized the cleavage site after Asp 345 in the C-terminal domain
16129781 These data suggest that MITF is an anti-proliferation factor that is down-regulated by B-RAF signaling and that this is a crucial event for the progression of melanomas that harbor oncogenic B-RAF.
16001072 MITF represents a distinct class of 'lineage survival' or 'lineage addiction' oncogenes required for both tissue-specific cancer development and tumour progression
15983061 We therefore conclude that the alpha-MSH/cAMP pathway, using MITF as a signal transducer and HIF1alpha as a target, might contribute to melanoma progression.
15884099 Simultaneous expression of the EWSR1-ATF1 and MITF-M transcripts in clear cell carcinoma has led to the proposal that the MITF-M promoter is transactivated by EWSR1-ATF1.
15715979 The majority of isoforms were found to be broadly expressed, with the M- and Mc-isoforms being tissue-restricted to melanocytes and mast cells, respectively.
15623583 MITF regulates p16INK4A expression in melanocytes.
15507434 the functional consequences of MITF sumoylation depend on promoter context. Sumoylation provides a possible mechanism for altering the effects of MITF by affecting the target genes that it activates
15205688 Mitf might play a role in the multinucleation process of giant cells and giant cell lesions.
14744763 MITF as a major transcriptional regulator of studies identify MITF as a major transcriptional regulator of TRPM1 and suggest that its prognostic value may be linked to MITF-mediated regulation of cellular differentiation
14737107 MITF and STAT3 cooperatively induce c-fos, resulting in cellular transformation
12944398 MITF expression in melanocytes is regulated by alpha-melanocyte-stimulating hormone modulated by SOX10
12819038 Data show that MITF appears to regulate the expression of the SILV and MLANA genes.
12753399 MITF-M plays dual roles in the Wnt signaling pathway; MITF-M represents a downstream target and a nuclear mediator of Wnt signals in melanocytes
12666593 MITF gene may be implicated in Waardenburg syndrome.
12235125 Beta catenin induced human melanoma growth requires the downstream target MITF
12204775 MITF regulates not only the expression of enzymes involved in melanin synthesis, but also the expression of a receptor which plays an essential role in melanocyte functions
12086670 Bcl2 regulation by the melanocyte master regulator Mitf modulates lineage survival and melanoma cell viability
12048204 MITF-M transactivates its own promoter (M promoter) by interacting with LEF-1
12032083 Microphthalmia-associated transcription factor interacts with LEF-1, a mediator of Wnt signaling
11764295 Microphthalmia-associated transcription factor (MITF) regulates the differentiation and development of melanocytes and retinal pigment epithelium and is also responsible for pigment cell-specific transcription of the melanogenesis enzyme genes. Review.
11751862 MAZR and MITF synergistically transactivated the mMCP-6 gene. MAZR appeared to play important roles in the normal phenotypic expression of mast cells in association with MITF

AA Sequence

MQSESGIVPDFEVGEEFHEEPKTYYELKSQPLKSSSSAEHPGASKPPISSSSMTSRILLRQQLMREQMQE      1 - 70
QERREQQQKLQAAQFMQQRVPVSQTPAINVSVPTTLPSATQVPMEVLKVQTHLENPTKYHIQQAQRQQVK     71 - 140
QYLSTTLANKHANQVLSLPCPNQPGDHVMPPVPGSSAPNSPMAMLTLNSNCEKEGFYKFEEQNRAESECP    141 - 210
GMNTHSRASCMQMDDVIDDIISLESSYNEEILGLMDPALQMANTLPVSGNLIDLYGNQGLPPPGLTISNS    211 - 280
CPANLPNIKRELTACIFPTESEARALAKERQKKDNHNLIERRRRFNINDRIKELGTLIPKSNDPDMRWNK    281 - 350
GTILKASVDYIRKLQREQQRAKELENRQKKLEHANRHLLLRIQELEMQARAHGLSLIPSTGLCSPDLVNR    351 - 420
IIKQEPVLENCSQDLLQHHADLTCTTTLDLTDGTITFNNNLGTGTEANQAYSVPTKMGSKLEDILMDDTL    421 - 490
SPVGVTDPLLSSVSPGASKTSSRRSSMSMEETEHTC                                      491 - 526
//

Text Mined References (234)

PMID Year Title
26962685 2016 Overcoming MITF-conferred drug resistance through dual AURKA/MAPK targeting in human melanoma cells.
26927636 2016 SOX5 is involved in balanced MITF regulation in human melanoma cells.
26773496 2016 Induction of MITF expression in human cholangiocarcinoma cells and hepatocellular carcinoma cells by cyclopamine, an inhibitor of the Hedgehog signaling.
26663054 2015 [Clinical classification and genetic mutation study of two pedigrees with type II Waardenburg syndrome].
26663053 2015 [Analysis of nuclear localization and signal function of MITF protein predisposing to Warrdenburg syndrome].
26650189 2016 Prevalence of MITF p.E318K in Patients With Melanoma Independent of the Presence of CDKN2A Causative Mutations.
26580798 2015 LEF-1 Regulates Tyrosinase Gene Transcription In Vitro.
26530832 2015 MITF and c-Jun antagonism interconnects melanoma dedifferentiation with pro-inflammatory cytokine responsiveness and myeloid cell recruitment.
26522736 2015 Microphthalmia-associated transcription factor is expressed in projection neurons of the mouse olfactory bulb.
26512583 2015 Molecular Etiology of Hereditary Single-Side Deafness: Its Association With Pigmentary Disorders and Waardenburg Syndrome.
26414466 2015 MiT Family Translocation-Associated Renal Cell Carcinoma: A Contemporary Update With Emphasis on Morphologic, Immunophenotypic, and Molecular Mimics.
26317170 2015 Microphthalmia transcription factor in malignant melanoma predicts occult sentinel lymph node metastases and survival.
26301891 2015 MITF is a critical regulator of the carcinoembryonic antigen-related cell adhesion molecule 1 (CEACAM1) in malignant melanoma.
26252099 2015 [Phenotypic and genetic analysis of a patient presented with Tietz/Waardenburg type II a syndrome].
26236014 2015 Interactions of Melanoma Cells with Distal Keratinocytes Trigger Metastasis via Notch Signaling Inhibition of MITF.
25975176 2015 The lack of E318K MITF germline mutation in Latvian melanoma patients.
25889792 2015 The transcription factor MITF is a critical regulator of GPNMB expression in dendritic cells.
25866058 2015 Microphthalmia-associated transcription factor expression levels in melanoma cells contribute to cell invasion and proliferation.
25865119 2015 Decoding the regulatory landscape of melanoma reveals TEADS as regulators of the invasive cell state.
25853464 2015 microRNA-155, induced by interleukin-1ß, represses the expression of microphthalmia-associated transcription factor (MITF-M) in melanoma cells.
25803486 2015 Transcription factor MITF and remodeller BRG1 define chromatin organisation at regulatory elements in melanoma cells.
25789707 2015 MITF Modulates Therapeutic Resistance through EGFR Signaling.
25705847 2015 Genome-Wide DNA Methylation Analysis in Melanoma Reveals the Importance of CpG Methylation in MITF Regulation.
25648896 2015 The intracellular domain of teneurin-1 induces the activity of microphthalmia-associated transcription factor (MITF) by binding to transcriptional repressor HINT1.
25605940 2015 MITF drives endolysosomal biogenesis and potentiates Wnt signaling in melanoma cells.
25502142 2014 Low MITF/AXL ratio predicts early resistance to multiple targeted drugs in melanoma.
25447045 2015 A novel role for microphthalmia-associated transcription factor-regulated pigment epithelium-derived factor during melanoma progression.
25433395 2015 MITF in melanoma: mechanisms behind its expression and activity.
25414259 2015 MicroRNA-340-mediated degradation of microphthalmia-associated transcription factor (MITF) mRNA is inhibited by coding region determinant-binding protein (CRD-BP).
25238448 2014 MITF positivity in atypical fibroxanthoma: a diagnostic pitfall.
25141921 2015 Pleiotrophin inhibits melanogenesis via Erk1/2-MITF signaling in normal human melanocytes.
25065405 2014 Mitochondrial dynamics regulate melanogenesis through proteasomal degradation of MITF via ROS-ERK activation.
25030625 2014 Regulatory and functional connection of microphthalmia-associated transcription factor and anti-metastatic pigment epithelium derived factor in melanoma.
25008112 2014 Loss of MITF expression during human embryonic stem cell differentiation disrupts retinal pigment epithelium development and optic vesicle cell proliferation.
24862846 2014 miR-330-5p targets tyrosinase and induces depigmentation.
24824743 2014 MicroRNA-218 inhibits melanogenesis by directly suppressing microphthalmia-associated transcription factor expression.
24789918 2014 Lysosomal stress in obese adipose tissue macrophages contributes to MITF-dependent Gpnmb induction.
24771846 2014 A melanoma cell state distinction influences sensitivity to MAPK pathway inhibitors.
24769727 2014 Identification of a ZEB2-MITF-ZEB1 transcriptional network that controls melanogenesis and melanoma progression.
24767713 2014 Prevalence of the E318K and V320I MITF germline mutations in Polish cancer patients and multiorgan cancer risk-a population-based study.
24733089 2014 Gene expression profiling identifies microphthalmia-associated transcription factor (MITF) and Dickkopf-1 (DKK1) as regulators of microenvironment-driven alterations in melanoma phenotype.
24706302 2014 Diagnostic performance of micropthalmia transcription factor for melanoma: a systematic review and meta-analysis.
24406078 2014 MITF E318K's effect on melanoma risk independent of, but modified by, other risk factors.
24390218 2014 A novel hypoxia-associated subset of FN1 high MITF low melanoma cells: identification, characterization, and prognostic value.
24379252 2013 [Hereditary hypomelanocytoses: the role of PAX3, SOX10, MITF, SNAI2, KIT, EDN3 and EDNRB genes].
24335901 2014 Reduced MiR-675 in exosome in H19 RNA-related melanogenesis via MITF as a direct target.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24290354 A germline oncogenic MITF mutation and tumor susceptibility.
24287867 2014 Downregulation of c-Kit/MITF-M in graying hair of juvenile poliosis.
24226203 2014 Evidence for an alternatively spliced MITF exon 2 variant.
24194866 2013 Genetic and phenotypic heterogeneity in Chinese patients with Waardenburg syndrome type II.
24107097 2013 A novel adamantyl benzylbenzamide derivative, AP736, suppresses melanogenesis through the inhibition of cAMP-PKA-CREB-activated microphthalmia-associated transcription factor and tyrosinase expression.
24039954 2013 New target genes of MITF-induced microRNA-211 contribute to melanoma cell invasion.
23962556 2013 MiR-101 inhibits melanoma cell invasion and proliferation by targeting MITF and EZH2.
23923085 2013 Micropthalmia transcription factor (MITF) as a diagnostic marker for metastatic melanomas negative for other melanoma markers.
23921446 2013 Association of MITF and other melanosome-related proteins with chemoresistance in melanoma tumors and cell lines.
23802662 2013 Malignant and benign tumors associated with multiple primary melanomas: just the starting block for the involvement of MITF, PTEN and CDKN2A in multiple cancerogenesis?
23787126 2013 MITF mutations associated with pigment deficiency syndromes and melanoma have different effects on protein function.
23782678 2014 Diagnostic utility and comparative immunohistochemical analysis of MITF-1 and SOX10 to distinguish melanoma in situ and actinic keratosis: a clinicopathological and immunohistochemical study of 70 cases.
23774529 2014 Phenotypic characterization of nevus and tumor patterns in MITF E318K mutation carrier melanoma patients.
23728343 2014 A chemical biology approach identifies AMPK as a modulator of melanoma oncogene MITF.
23480510 2013 BRG1 promotes survival of UV-irradiated melanoma cells by cooperating with MITF to activate the melanoma inhibitor of apoptosis gene.
23477830 2013 Oncogenic BRAF regulates oxidative metabolism via PGC1? and MITF.
23349796 2013 MITF-independent pro-survival role of BRG1-containing SWI/SNF complex in melanoma cells.
23275444 2013 Identification of the hypoxia-inducible factor 2? nuclear interactome in melanoma cells reveals master proteins involved in melanoma development.
23223141 2013 Liver X receptor activation inhibits melanogenesis through the acceleration of ERK-mediated MITF degradation.
23201126 2013 PGC-1 coactivators regulate MITF and the tanning response.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23167872 2013 Prevalence of the E318K MITF germline mutation in Italian melanoma patients: associations with histological subtypes and family cancer history.
23098757 2012 Functional analysis of MITF gene mutations associated with Waardenburg syndrome type 2.
22898827 2012 The changes of microRNA expression profiles and tyrosinase related proteins in MITF knocked down melanocytes.
22848661 2012 Screening of MITF and SOX10 regulatory regions in Waardenburg syndrome type 2.
22848417 2012 Role of microRNA-182 in posterior uveal melanoma: regulation of tumor development through MITF, BCL2 and cyclin D2.
22833560 2012 Placenta to cartilage: direct conversion of human placenta to chondrocytes with transformation by defined factors.
22668579 2013 MITF accurately highlights epidermal melanocytes in atypical intraepidermal melanocytic proliferations.
22647378 2012 The tumor suppressor HINT1 regulates MITF and ?-catenin transcriptional activity in melanoma cells.
22594792 2012 Breast cancer suppressor candidate-1 (BCSC-1) is a melanoma tumor suppressor that down regulates MITF.
22571403 2012 SOX2 modulates levels of MITF in normal human melanocytes, and melanoma lines in vitro.
22523078 2012 Microphthalmia-associated transcription factor (MITF) promotes differentiation of human retinal pigment epithelium (RPE) by regulating microRNAs-204/211 expression.
22496449 2012 Expression of microphthalmia-associated transcription factor (MITF), which is critical for melanoma progression, is inhibited by both transcription factor GLI2 and transforming growth factor-?.
22441367 2012 Expression of MiTF may be helpful in differentiating cellular neurothekeoma from plexiform fibrohistiocytic tumor (histiocytoid predominant) in a partial biopsy specimen.
22320238 2013 Double heterozygous mutations of MITF and PAX3 result in Waardenburg syndrome with increased penetrance in pigmentary defects.
22258527 2012 Novel and recurrent non-truncating mutations of the MITF basic domain: genotypic and phenotypic variations in Waardenburg and Tietz syndromes.
22234890 2012 HERC2 rs12913832 modulates human pigmentation by attenuating chromatin-loop formation between a long-range enhancer and the OCA2 promoter.
22196401 2011 A novel mutation in the MITF may be digenic with GJB2 mutations in a large Chinese family of Waardenburg syndrome type II.
22131883 2011 Activation of the long terminal repeat of human endogenous retrovirus K by melanoma-specific transcription factor MITF-M.
22115973 2012 Microphthalmia-associated transcription factor acts through PEDF to regulate RPE cell migration.
22080950 2011 A novel recurrent mutation in MITF predisposes to familial and sporadic melanoma.
22012259 2011 A SUMOylation-defective MITF germline mutation predisposes to melanoma and renal carcinoma.
21996743 2012 Hypoxia and MITF control metastatic behaviour in mouse and human melanoma cells.
21981993 2012 Inhibition of coding region determinant binding protein sensitizes melanoma cells to chemotherapeutic agents.
21949374 2011 Hypoxia-induced transcriptional repression of the melanoma-associated oncogene MITF.
21887372 2011 C-KIT signaling depends on microphthalmia-associated transcription factor for effects on cell proliferation.
21873430 2011 The E-box binding factors Max/Mnt, MITF, and USF1 act coordinately with FoxO to regulate expression of proapoptotic and cell cycle control genes by phosphatidylinositol 3-kinase/Akt/glycogen synthase kinase 3 signaling.
21811243 2011 Regulation of MITF stability by the USP13 deubiquitinase.
21801332 2011 GLI2 and M-MITF transcription factors control exclusive gene expression programs and inversely regulate invasion in human melanoma cells.
21797920 2011 Quantitative comparison of MiTF, Melan-A, HMB-45 and Mel-5 in solar lentigines and melanoma in situ.
21796150 2011 Human cutaneous melanomas lacking MITF and melanocyte differentiation antigens express a functional Axl receptor kinase.
21771814 2011 Differentiated melanocyte cell division occurs in vivo and is promoted by mutations in Mitf.
21610457 2011 Immunohistochemical double stains against Ki67/MART1 and HMB45/MITF: promising diagnostic tools in melanocytic lesions.
21577209 2011 In melanoma, beta-catenin is a suppressor of invasion.
21438779 Novel splice mutation in microthalmia-associated transcription factor in Waardenburg Syndrome.
21362015 2011 An immunohistochemical comparison between MiTF and MART-1 with Azure blue counterstaining in the setting of solar lentigo and melanoma in situ.
21358674 2011 Inverse expression states of the BRN2 and MITF transcription factors in melanoma spheres and tumour xenografts regulate the NOTCH pathway.
21326905 Dual roles of lineage restricted transcription factors: the case of MITF in melanocytes.
21324898 2011 HDAC3 and HDAC7 have opposite effects on osteoclast differentiation.
21273305 2011 KIT signaling regulates MITF expression through miRNAs in normal and malignant mast cell proliferation.
21209915 2010 Inactivation of the FLCN tumor suppressor gene induces TFE3 transcriptional activity by increasing its nuclear localization.
21203491 2010 A role for ATF2 in regulating MITF and melanoma development.
21164369 2011 PAX3 knockdown in metastatic melanoma cell lines does not reduce MITF expression.
21070662 2010 Schizophrenia and vitamin D related genes could have been subject to latitude-driven adaptation.
20973930 2010 Lighting a path to pigmentation: mechanisms of MITF induction by UV.
20952536 2010 Control of melanocyte differentiation by a MITF-PDE4D3 homeostatic circuit.
20807369 2010 The discovery of the microphthalmia locus and its gene, Mitf.
20801516 2011 Simultaneous mutation detection in 90 retinal disease genes in multiple patients using a custom-designed 300-kb retinal resequencing chip.
20701798 2010 MiTF links Erk1/2 kinase and p21 CIP1/WAF1 activation after UVC radiation in normal human melanocytes and melanoma cells.
20644734 2010 miR-148 regulates Mitf in melanoma cells.
20573688 2010 A novel isoform of microphthalmia-associated transcription factor inhibits IL-8 gene expression in human cervical stromal cells.
20550935 2010 Lineage-specific transcriptional regulation of DICER by MITF in melanocytes.
20530484 2010 SOX9, through interaction with microphthalmia-associated transcription factor (MITF) and OTX2, regulates BEST1 expression in the retinal pigment epithelium.
20514666 2010 Rapid frozen section immunostaining of melanocytes by microphthalmia-associated transcription factor.
20513998 2010 Involvement of MITF-A, an alternative isoform of mi transcription factor, on the expression of tryptase gene in human mast cells.
20485200 2010 Effect of the mutant microphthalmia-associated transcription factor found in Tietz syndrome on the in vitro development of mast cells.
20482673 2010 The correlation of TRPM1 (Melastatin) mRNA expression with microphthalmia-associated transcription factor (MITF) and other melanogenesis-related proteins in normal and pathological skin, hair follicles and melanocytic nevi.
20478267 2010 Novel mutations of PAX3, MITF, and SOX10 genes in Chinese patients with type I or type II Waardenburg syndrome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20201954 2010 "Transcription physiology" of pigment formation in melanocytes: central role of MITF.
20163701 2010 Mitf-Mdel, a novel melanocyte/melanoma-specific isoform of microphthalmia-associated transcription factor-M, as a candidate biomarker for melanoma.
20099279 2010 Interleukins 1alpha and 1beta secreted by some melanoma cell lines strongly reduce expression of MITF-M and melanocyte differentiation antigens.
20083088 2010 SWI/SNF chromatin remodeling complex is critical for the expression of microphthalmia-associated transcription factor in melanoma cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19895547 2010 ERK-regulated differential expression of the Mitf 6a/b splicing isoforms in melanoma.
19805117 2009 A genomic screen identifies TYRO3 as a MITF regulator in melanoma.
19784067 2010 Heterogeneous SWI/SNF chromatin remodeling complexes promote expression of microphthalmia-associated transcription factor target genes in melanoma.
19659611 2009 Simultaneous suppression of MITF and BRAF V600E enhanced inhibition of melanoma cell proliferation.
19496784 2009 Low expression of microphthalmia-associated transcription factor, a potential molecular target for interferon-alpha susceptibility, is associated with metastasis in renal cell carcinoma.
19464596 2009 Transcriptional regulation in melanoma.
19422606 2009 Frequent mutations in the MITF pathway in melanoma.
19320733 2009 Pigmentation-related genes and their implication in malignant melanoma susceptibility.
19188590 2009 Aberrant miR-182 expression promotes melanoma metastasis by repressing FOXO3 and microphthalmia-associated transcription factor.
18971960 2009 MiTF regulates cellular response to reactive oxygen species through transcriptional regulation of APE-1/Ref-1.
18829533 2008 Brn-2 represses microphthalmia-associated transcription factor expression and marks a distinct subpopulation of microphthalmia-associated transcription factor-negative melanoma cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18636124 2008 Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma.
18628967 2008 Oncogenic BRAF regulates melanoma proliferation through the lineage specific factor MITF.
18595666 2008 A novel MITF splice site mutation in a family with Waardenburg syndrome.
18478240 2008 LPS induces melanogenesis through p38 MAPK activation in human melanocytes.
18457359 2008 Inhibition of MITF and tyrosinase by paeonol-stimulated JNK/SAPK to reduction of phosphorylated CREB.
18451137 2008 Microphthalmia-associated transcription factor is a critical transcriptional regulator of melanoma inhibitor of apoptosis in melanomas.
18424413 2008 [Mutation screening of MITF gene in patients with Waardenburg syndrome type 2].
18316599 2008 MicroRNA-137 targets microphthalmia-associated transcription factor in melanoma cell lines.
18284417 2009 MITF-CM, a newly identified isoform of microphthalmia-associated transcription factor, is expressed in cultured mast cells.
18281284 2008 Microphthalmia-associated transcription factor regulates RAB27A gene expression and controls melanosome transport.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18039926 2008 Epistatic connections between microphthalmia-associated transcription factor and endothelin signaling in Waardenburg syndrome and other pigmentary disorders.
17975146 2007 Microphthalmia-associated transcription factor gene amplification in metastatic melanoma is a prognostic marker for patient survival, but not a predictive marker for chemosensitivity and chemotherapy response.
17627390 2007 The value of MLPA in Waardenburg syndrome.
17516926 2007 Evolutionary sequence comparison of the Mitf gene reveals novel conserved domains.
17464203 2007 Microphthalmia-associated transcription factor polymorphisms and association with bone mineral density of the proximal femur in postmenopausal women.
17250547 2007 Inhibition of MITF transcriptional activity independent of targeting p300/CBP coactivators.
17182868 2006 Mitf regulation of Dia1 controls melanoma proliferation and invasiveness.
17159916 2007 The effects of dickkopf 1 on gene expression and Wnt signaling by melanocytes: mechanisms underlying its suppression of melanocyte function and proliferation.
16766266 2006 Oncogenic MITF dysregulation in clear cell sarcoma: defining the MiT family of human cancers.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16586042 2007 Tacrolimus and cyclosporine A inhibit human osteoclast formation via targeting the calcineurin-dependent NFAT pathway and an activation pathway for c-Jun or MITF in rheumatoid arthritis.
16524430 2006 Sphingosylphosphorylcholine-induced ERK activation inhibits melanin synthesis in human melanocytes.
16510564 2006 From integrated genomics to tumor lineage dependency.
16489066 2006 Microphthalmia transcription factor as a molecular marker for circulating tumor cell detection in blood of melanoma patients.
16455654 2006 c-Met expression is regulated by Mitf in the melanocyte lineage.
16420247 2006 Glutamate receptors on human melanocytes regulate the expression of MiTF.
16411896 2006 MITF mediates cAMP-induced protein kinase C-beta expression in human melanocytes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16140982 2005 The cleavage of microphthalmia-associated transcription factor, MITF, by caspases plays an essential role in melanocyte and melanoma cell apoptosis.
16129781 2005 Elevated expression of MITF counteracts B-RAF-stimulated melanocyte and melanoma cell proliferation.
16001072 2005 Integrative genomic analyses identify MITF as a lineage survival oncogene amplified in malignant melanoma.
15983061 2005 Hypoxia-inducible factor 1{alpha} is a new target of microphthalmia-associated transcription factor (MITF) in melanoma cells.
15884099 2005 Fusion of the EWSR1 and ATF1 genes without expression of the MITF-M transcript in angiomatoid fibrous histiocytoma.
15715979 2005 Genomic analysis of the Microphthalmia locus and identification of the MITF-J/Mitf-J isoform.
15623583 2005 MITF links differentiation with cell cycle arrest in melanocytes by transcriptional activation of INK4A.
15507434 2005 Sumoylation of MITF and its related family members TFE3 and TFEB.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15205688 2004 Immunohistochemical evaluation of microphthalmia-associated transcription factor expression in giant cell lesions.
14975237 2004 The function of lysyl-tRNA synthetase and Ap4A as signaling regulators of MITF activity in FcepsilonRI-activated mast cells.
14744763 2004 Transcriptional regulation of the melanoma prognostic marker melastatin (TRPM1) by MITF in melanocytes and melanoma.
14737107 2004 STAT3 and MITF cooperatively induce cellular transformation through upregulation of c-fos expression.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
13985019 1963 A syndrome of deaf-mutism associated with albinism showing dominant autosomal inheritance.
12944398 2003 A tissue-restricted cAMP transcriptional response: SOX10 modulates alpha-melanocyte-stimulating hormone-triggered expression of microphthalmia-associated transcription factor in melanocytes.
12819038 2003 MLANA/MART1 and SILV/PMEL17/GP100 are transcriptionally regulated by MITF in melanocytes and melanoma.
12753399 2003 Microphthalmia-associated transcription factor in the Wnt signaling pathway.
12666593 2003 [Clinical and molecular genetic investigation of Waardenburg syndrome type 1].
12663655 2003 OTX2 activates the molecular network underlying retina pigment epithelium differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12235125 2002 Beta-catenin-induced melanoma growth requires the downstream target Microphthalmia-associated transcription factor.
12204775 2002 Involvement of microphthalmia-associated transcription factor (MITF) in expression of human melanocortin-1 receptor (MC1R).
12086670 2002 Bcl2 regulation by the melanocyte master regulator Mitf modulates lineage survival and melanoma cell viability.
12048204 2002 Melanocyte-specific microphthalmia-associated transcription factor isoform activates its own gene promoter through physical interaction with lymphoid-enhancing factor 1.
12032083 2002 Microphthalmia-associated transcription factor interacts with LEF-1, a mediator of Wnt signaling.
11955610 2002 Mitf-D, a newly identified isoform, expressed in the retinal pigment epithelium and monocyte-lineage cells affected by Mitf mutations.
11930005 2002 Mitf and Tfe3, two members of the Mitf-Tfe family of bHLH-Zip transcription factors, have important but functionally redundant roles in osteoclast development.
11929831 2002 The melanocyte-specific isoform of the microphthalmia transcription factor affects the phenotype of human melanoma.
11818452 2002 The microphthalmia transcription factor and the related helix-loop-helix zipper factors TFE-3 and TFE-C collaborate to activate the tartrate-resistant acid phosphatase promoter.
11792706 2002 Microphthalmia transcription factor is a target of the p38 MAPK pathway in response to receptor activator of NF-kappa B ligand signaling.
11764295 2001 Microphthalmia-associated transcription factor (MITF): multiplicity in structure, function, and regulation.
11751862 2002 Interaction and cooperation of mi transcription factor (MITF) and myc-associated zinc-finger protein-related factor (MAZR) for transcription of mouse mast cell protease 6 gene.
11709556 2002 A new role for the STAT3 inhibitor, PIAS3: a repressor of microphthalmia transcription factor.
11350962 2001 Specific Pax-6/microphthalmia transcription factor interactions involve their DNA-binding domains and inhibit transcriptional properties of both proteins.
11331755 2001 Linking osteopetrosis and pycnodysostosis: regulation of cathepsin K expression by the microphthalmia transcription factor family.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11176068 2001 Analysis of microphthalmia transcription factor expression in normal tissues and tumors, and comparison of its expression with S-100 protein, gp100, and tyrosinase in desmoplastic malignant melanoma.
10851256 2000 Tietz syndrome (hypopigmentation/deafness) caused by mutation of MITF.
10760582 2000 Structural organization of the human microphthalmia-associated transcription factor gene containing four alternative promoters.
10694430 2000 Regulation of microphthalmia-associated transcription factor MITF protein levels by association with the ubiquitin-conjugating enzyme hUBC9.
10673502 2000 c-Kit triggers dual phosphorylations, which couple activation and degradation of the essential melanocyte factor Mi.
10587587 2000 Ser298 of MITF, a mutation site in Waardenburg syndrome type 2, is a phosphorylation site with functional significance.
10578055 1999 Molecular cloning of cDNA encoding a novel microphthalmia-associated transcription factor isoform with a distinct amino-terminus.
9918847 1999 Microphthalmia-associated transcription factor interacts with PU.1 and c-Fos: determination of their subcellular localization.
9856573 1998 Point mutation in the MITF gene causing Waardenburg syndrome type II in a three-generation Indian family.
9806910 1998 The bHLH-Zip transcription factor Tfeb is essential for placental vascularization.
9700169 1998 Microphthalmia gene product as a signal transducer in cAMP-induced differentiation of melanocytes.
9660747 1998 Lineage-specific signaling in melanocytes. C-kit stimulation recruits p300/CBP to microphthalmia.
9647758 1998 Identification of a novel isoform of microphthalmia-associated transcription factor that is enriched in retinal pigment epithelium.
9500554 1998 Epistatic relationship between Waardenburg syndrome genes MITF and PAX3.
9440696 1998 MAP kinase links the transcription factor Microphthalmia to c-Kit signalling in melanocytes.
9158138 1997 Apparent digenic inheritance of Waardenburg syndrome type 2 (WS2) and autosomal recessive ocular albinism (AROA).
8995290 1997 Functional analysis of microphthalmia-associated transcription factor in pigment cell-specific transcription of the human tyrosinase family genes.
8659547 1996 Analyses of loss-of-function mutations of the MITF gene suggest that haploinsufficiency is a cause of Waardenburg syndrome type 2A.
8645245 1996 Identification of a melanocyte-type promoter of the microphthalmia-associated transcription factor gene.
8589691 1995 The mutational spectrum in Waardenburg syndrome.
8069297 1994 Cloning of MITF, the human homolog of the mouse microphthalmia gene and assignment to chromosome 3p14.1-p12.3.
7969144 1994 Microphthalmia-associated transcription factor as a regulator for melanocyte-specific transcription of the human tyrosinase gene.
7951321 1994 A gene for Waardenburg syndrome type 2 maps close to the human homologue of the microphthalmia gene at chromosome 3p12-p14.1.
7874167 1994 Waardenburg syndrome type 2 caused by mutations in the human microphthalmia (MITF) gene.
666627 1978 Heterogeneity in Waardenburg's syndrome. Report of a family with ocular albinism.