Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.10
PubTator Score 3.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Gene RIF (3)

AA Sequence

MAKSGLRQDPQSTAAATVLKRAVELDSESRYPQALVCYQEGIDLLLQVLKGTKDNTKRCNLREKISKYMD      1 - 70
RAENIKKYLDQEKEDGKYHKQIKIEENATGFSYESLFREYLNETVTEVWIEDPYIRHTHQLYNFLRFCEM     71 - 140
LIKRPCKVKTIHLLTSLDEGIEQVQQSRGLQEIEESLRSHGVLLEVQYSSSIHDREIRFNNGWMIKIGRG    141 - 210
LDYFKKPQSRFSLGYCDFDLRPCHETTVDIFHKKHTKNI                                   211 - 249
//

Text Mined References (19)

PMID Year Title