Property Summary

NCBI Gene PubMed Count 9
PubMed Score 26.77
PubTator Score 21.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6514 3.6e-18
malignant mesothelioma 3135 6.9e-09
osteosarcoma 7766 4.7e-06
lung cancer 4607 7.1e-04
esophageal adenocarcinoma 696 1.9e-02
Barrett's esophagus 173 4.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.6
Disease Target Count Z-score Confidence
Cone dystrophy 68 3.439 1.7
Microphthalmia 72 3.395 1.7

Expression

  Differential Expression (6)

Disease log2 FC p
Barrett's esophagus 1.400 4.2e-02
esophageal adenocarcinoma 1.600 1.9e-02
lung cancer 1.700 7.1e-04
malignant mesothelioma 3.500 6.9e-09
osteosarcoma 1.668 4.7e-06
psoriasis -1.200 3.6e-18

Gene RIF (5)

AA Sequence

MDRVTRYPILGIPQAHRGTGLVLDGDTSYTYHLVCMGPEASGWGQDEPQTWPTDHRAQQGVQRQGVSYSV      1 - 70
HAYTGQPSPRGLHSENREDEGWQVYRLGARDAHQGRPTWALRPEDGEDKEMKTYRLDAGDADPRRLCDLE     71 - 140
RERWAVIQGQAVRKSSTVATLQGTPDHGDPRTPGPPRSTPLEENVVDREQIDFLAARQQFLSLEQANKGA    141 - 210
PHSSPARGTPAGTTPGASQAPKAFNKPHLANGHVVPIKPQVKGVVREENKVRAVPTWASVQVVDDPGSLA    211 - 280
SVESPGTPKETPIEREIRLAQEREADLREQRGLRQATDHQELVEIPTRPLLTKLSLITAPRRERGRPSLY    281 - 350
VQRDIVQETQREEDHRREGLHVGRASTPDWVSEGPQPGLRRALSSDSILSPAPDARAADPAPEVRKVNRI    351 - 420
PPDAYQPYLSPGTPQLEFSAFGAFGKPSSLSTAEAKAATSPKATMSPRHLSESSGKPLSTKQEASKPPRG    421 - 490
CPQANRGVVRWEYFRLRPLRFRAPDEPQQAQVPHVWGWEVAGAPALRLQKSQSSDLLERERESVLRREQE    491 - 560
VAEERRNALFPEVFSPTPDENSDQNSRSSSQASGITGSYSVSESPFFSPIHLHSNVAWTVEDPVDSAPPG    561 - 630
QRKKEQWYAGINPSDGINSEVLEAIRVTRHKNAMAERWESRIYASEEDD                         631 - 679
//

Text Mined References (14)

PMID Year Title