Property Summary

NCBI Gene PubMed Count 11
PubMed Score 12.88
PubTator Score 5.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adrenocortical carcinoma 1.406 7.4e-04
glioblastoma 1.100 4.2e-05
group 3 medulloblastoma 1.200 4.2e-03
intraductal papillary-mucinous adenoma (... 1.500 1.1e-02
intraductal papillary-mucinous carcinoma... 1.800 3.0e-03
intraductal papillary-mucinous neoplasm ... 1.200 1.2e-02
lung carcinoma -1.400 3.4e-17
medulloblastoma, large-cell 1.200 1.0e-02
osteosarcoma -2.679 4.9e-06
ovarian cancer 1.100 6.3e-03
psoriasis -3.600 4.5e-05
Rheumatoid arthritis 2.100 4.4e-03

 GO Function (1)

Gene RIF (2)

AA Sequence

MIATPLKHSRIYLPPEASSQRRNLPMDAIFFDSIPSGTLTPVKDLVKYQNSSLKLNDHKKNQFLKMTTFN      1 - 70
NKNIFQSTMLTEATTSNSSLDISAIKPNKDGLKNKANYESPGKIFLRMKEKVLRDKQEQPSRNSSLLEPQ     71 - 140
KSGNNETFTPNRVEKKKLQHTYLCEEKENNKSFQSDDSSLRASVQGVPLESSNNDIFLPVKQKIQCQQEK    141 - 210
KAPLHNLTYELPTLNQEQENFLAVEARNKTLTRAQLAKQIFHSKESIVATTKSKKDTFVLESVDSADEQF    211 - 280
QNTNAETLSTNCIPIKNGSLLMVSDSERTTEGTSQQKVKEGNGKTVPGETGLPGSMKDTCKIVLATPRLH    281 - 350
ITIPRRSKRNISKLSPPRIFQTVTNGLKKNQVVQLQEWMIKSINNNTAICVEGKLIDVTNIYWHSNVIIE    351 - 420
RIEHNKLRTISGNVYILKGMIDQISMKEAGYPNYLIRKFMFGFPENWKEHIDNFLEQLRAGEKNREKTKQ    421 - 490
KQKTGRSVRDIRKSMKNDARENQTDTAQRATTTYDFDCDNLELKSNKHSESPGATELNMCHSNCQNKPTL    491 - 560
RFPDDQVNNTIQNGGGDDLSNQELIGKKEYKMSSKKLKIGERTNERIIKSQKQETTEELDVSIDILTSRE    561 - 630
QFFSDEERKYMAINQKKAYILVTPLKSRKVIEQRCMRYNLSAGTIKAVTDFVIPECQKKSPISKSMGTLE    631 - 700
NTFEGHKSKNKEDCDERDLLTVNRKIKISNLEKEQMLTSDFKKNTRLLPKLKKIENQVAMSFYKHQSSPD    701 - 770
LSSEESETEKEIKRKAEVKKTKAGNTKEAVVHLRKSTRNTSNIPVILEPETEESENEFYIKQKKARPSVK    771 - 840
ETLQKSGVRKEFPITEAVGSDKTNRHPLECLPGLIQDKEWNEKELQKLHCAFASLPKHKPGFWSEVAAAV    841 - 910
GSRSPEECQRKYMENPRGKGSQKHVTKKKPANSKGQNGKRGDADQKQTIKITAKVGTLKRKQQMREFLEQ    911 - 980
LPKDDHDDFFSTTPLQHQRILLPSFQDSEDDDDILPNMDKNPTTPSSVIFPLVKTPQCQHVSPGMLGSIN    981 - 1050
RNDCDKYVFRMQKYHKSNGGIVWGNIKKKLVETDFSTPTPRRKTPFNTDLGENSGIGKLFTNAVESLDEE   1051 - 1120
EKDYYFSNSDSA                                                             1121 - 1132
//

Text Mined References (20)

PMID Year Title