Property Summary

NCBI Gene PubMed Count 16
PubMed Score 100.96
PubTator Score 22.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma 1.500 2.6e-06
glioblastoma 1.500 2.0e-05
osteosarcoma -1.111 1.2e-02
sonic hedgehog group medulloblastoma 2.400 3.6e-06
medulloblastoma, large-cell 1.600 1.9e-04
primitive neuroectodermal tumor 1.200 1.1e-03
adrenocortical carcinoma 1.082 7.1e-03
non-small cell lung cancer 1.528 3.8e-22
intraductal papillary-mucinous neoplasm ... 1.700 6.9e-04
lung cancer 1.900 3.6e-04
pediatric high grade glioma 1.400 1.2e-03
atypical teratoid/rhabdoid tumor 1.300 2.0e-04
aldosterone-producing adenoma -1.094 9.6e-03
lung adenocarcinoma 1.100 2.3e-08
nasopharyngeal carcinoma 1.200 1.3e-03
psoriasis 1.100 8.3e-12
ovarian cancer 1.400 3.6e-03

 GO Function (1)

Gene RIF (3)

PMID Text
26942680 Stable binding of Mis18alpha-Mis18beta heterotetramer to centromeres in telophase licenses them for CENP-A deposition.
17199038 Three human proteins essential for centromere/kinetochore structure and function, hMis18alpha, hMis18beta, and M18BP1, the complex of which is accumulated specifically at the telophase-G1 centromere, are identified.[Mis18alpha, Mis18beta, M18BP1]
15881666 it is suggested that pp5644 physically bind to FASP1

AA Sequence

MAGVRSLRCSRGCAGGCECGDKGKCSDSSLLGKRLSEDSSRHQLLQKWASMWSSMSEDASVADMERAQLE      1 - 70
EEAAAAEERPLVFLCSGCRRPLGDSLSWVASQEDTNCILLRCVSCNVSVDKEQKLSKREKENGCVLETLC     71 - 140
CAGCSLNLGYVYRCTPKNLDYKRDLFCLSVEAIESYVLGSSEKQIVSEDKELFNLESRVEIEKSLTQMED    141 - 210
VLKALQMKLWEAESKLSFATCKS                                                   211 - 233
//

Text Mined References (21)

PMID Year Title
26942680 2016 Licensing of Centromeric Chromatin Assembly through the Mis18?-Mis18? Heterotetramer.
26921242 2016 Centromere localization and function of Mis18 requires Yippee-like domain-mediated oligomerization.
25416956 2014 A proteome-scale map of the human interactome network.
25036634 2014 Polo-like kinase 1 licenses CENP-A deposition at centromeres.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17199038 2007 Priming of centromere for CENP-A recruitment by human hMis18alpha, hMis18beta, and M18BP1.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15881666 2005 P5644 interacts with phosphatidylinositol-4-phosphate adaptor protein-1 associated protein-1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12036298 2002 Annotation of human chromosome 21 for relevance to Down syndrome: gene structure and expression analysis.
11001876 2000 Identification of pleckstrin-homology-domain-containing proteins with novel phosphoinositide-binding specificities.
10830953 2000 The DNA sequence of human chromosome 21.
10773462 2000 Criteria for gene identification and features of genome organization: analysis of 6.5 Mb of DNA sequence from human chromosome 21.