Property Summary

NCBI Gene PubMed Count 21
PubMed Score 5.38
PubTator Score 15.71

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
posterior fossa group A ependymoma 1.400 1.1e-07
glioblastoma 1.100 3.5e-05
primitive neuroectodermal tumor 1.100 4.7e-04
group 3 medulloblastoma 1.400 1.5e-02
ovarian cancer -1.700 2.2e-05

Gene RIF (7)

PMID Text
25601404 Mechanisms of mitosis-specific assembly of the checkpoint platform Knl1/MIS12/NDC80 at human kinetochores.
24530301 RWD-containing proteins interact with the Mis12 complex to shape KMN network topology, as revealed by structural analysis
21875947 HIV-1 Vpr interferes with the heterochromatin structure by displacing HP1-alpha and HP1-gamma proteins in interphase, which leads to relocalization of the centromere chromatin proteins Mis12, Sgo1, and CPC after prophase
21353556 Direct binding of Cenp-C to the Mis12 complex joins the inner and outer kinetochore.
20404110 These findings support a novel role for Hsp90-Sgt1 chaperones in ensuring the fidelity of Mis12 multiprotein complex assembly.
16585270 These results indicate that a four-subunit Mis12 complex plays an essential role in chromosome segregation in vertebrates and contributes to mitotic kinetochore assembly.
12515822 hMIS12 has a role in mitosis and localizes at kinetochores

AA Sequence

MSVDPMTYEAQFFGFTPQTCMLRIYIAFQDYLFEVMQAVEQVILKKLDGIPDCDISPVQIRKCTEKFLCF      1 - 70
MKGHFDNLFSKMEQLFLQLILRIPSNILLPEDKCKETPYSEEDFQHLQKEIEQLQEKYKTELCTKQALLA     71 - 140
ELEEQKIVQAKLKQTLTFFDELHNVGRDHGTSDFRESLVSLVQNSRKLQNIRDNVEKESKRLKIS         141 - 205
//

Text Mined References (22)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25601404 2015 Multiple assembly mechanisms anchor the KMN spindle checkpoint platform at human mitotic kinetochores.
25416956 2014 A proteome-scale map of the human interactome network.
24530301 2014 Modular assembly of RWD domains on the Mis12 complex underlies outer kinetochore organization.
23891108 2013 Lateral to end-on conversion of chromosome-microtubule attachment requires kinesins CENP-E and MCAK.
21353556 2011 Direct binding of Cenp-C to the Mis12 complex joins the inner and outer kinetochore.
21269460 2011 Initial characterization of the human central proteome.
20404110 2010 Hsp90-Sgt1 and Skp1 target human Mis12 complexes to ensure efficient formation of kinetochore-microtubule binding sites.
20360068 2010 Systematic analysis of human protein complexes identifies chromosome segregation proteins.
16585270 2006 The human Mis12 complex is required for kinetochore assembly and proper chromosome segregation.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15502821 2004 A conserved Mis12 centromere complex is linked to heterochromatic HP1 and outer kinetochore protein Zwint-1.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15371340 2004 A conserved protein network controls assembly of the outer kinetochore and its ability to sustain tension.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12515822 2003 Human centromere chromatin protein hMis12, essential for equal segregation, is independent of CENP-A loading pathway.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.