Property Summary

NCBI Gene PubMed Count 61
PubMed Score 0.00
PubTator Score 29.49

Knowledge Summary

Patent

No data available

Gene RIF (50)

PMID Text
26837962 MIR17HG gene expression is dysregulated in gastric cancer.
26545119 vFLIP and vCyclin induce the oncogenic miR-17-92 cluster in endothelial cells
26360630 Germline heterozygous deletions of MIR17HG is associated with feingold syndrome-2.
26233958 Our findings demonstrate an important role of the miR-17-92 cluster in hepatocarcinogenesis and suggest the possibility of targeting this pivotal miRNA cluster for potential therapy.
25887381 Our findings identify the miR-17-92 cluster as a functionally determining family of miRNAs in pancreatic cancer stem cells, and highlight the putative potential of developing modulators of this cluster to overcome drug resistance in pancreatic CSCs.
25870038 Functional interactions among members of the miR-17-92 cluster in lymphocyte development, differentiation and malignant transformation
25732734 WEE1 is a valid target of the miR-17-92 cluster in leukemia.
25634356 The oncogenic miR-17-92 cluster is involved in cutaneous B-cell lymphoma progression.
25415674 The current results of our study support a relationship between the miR-17-92 family and lipid metabolism
25359779 STAT3 activation is related to the up-regulation of miR-17-92 clusters in retinoblastoma cells via positive feedback loop between them
25239565 A novel IL-6/Stat3-miR-17-92 cluster-PTEN signaling axis is crucial for cholangiocarcinogenesis and tumor progression.
25140305 the high sensitivity of leukemia cells to HQ17(3) may be associated with the reduction of topo IIalpha and c-Myc activities, as well as with the downregulation of the miR-17-92 cluster expression.
24645838 Upregulation of microRNA-17-92 cluster associates with tumor progression in osteosarcoma.
24625819 miR-17-92, particularly miR-19 as a key component, can induce proliferation of cardiomyocytes and help protect the heart from ischemic injury caused by Myocardial infarction.
24583285 The promoter of the miR-17-92 gene cluster is transactivated through the promoter binding of STAT3 while BIM expression is decreasesed during Toxoplasma gondii infection.
24469837 Study describes a novel mechanism, involving c-Myc and miR-17-92, which integrates cell proliferation and apoptosis resistance.
24378993 BMPR2 downregulation is mediated by miR-17-92.
24305714 High miR-17-92 expression is associated with pediatric high-grade glioma.
24280866 data demonstrate the role of miR-17~92 in regulation of apoptosis, and identify BCL2 as a therapeutic target of particular relevance in BCR-ABL-positive ALL.
24169826 The Myc-miR-17-92-BCR axis, frequently affected by genomic rearrangements, constitutes a novel lymphomagenic feed-forward loop.
24145352 miR-17-92 cluster family is involved in medulloblastoma progression.
24068957 our data indicate that miR-17-92 modulates expression of critical T-box transcriptional regulators during midface development and is itself a target of Bmp-signaling and the craniofacial pioneer factor AP-2alpha
23921550 miR-17~92 is a powerful cancer driver that coordinates the activation of multiple oncogenic pathways in lymphomagenesis
23858035 The miR-17-92 cluster was specifically required for the accumulation of activated Ag-specific Treg and for differentiation into IL-10-producing effector Treg.
23825564 the upregulation of miR-17-92 may play a role in the biology of adenoid cystic carcinoma
23759744 miR-17~92 miRNA cluster is up-regulated in transgenic mouse models of polycystic kidney disease.
23550645 The structural complexity of mir-17-92 as a polycistronic miRNA oncogene, along with the complex mode of interactions among its components, constitutes the molecular basis for its unique functional complexity during normal and tumor development.[Review]
23546593 The combined detection of PTEN and miR-92 may provide critical clinical evidence for the early diagnosis and prognosis of hepatocellular carcinoma.
23532756 c-Myc-mediated overexpression of miR-17-92 suppresses replication of hepatitis B virus in human hepatoma cells.
23438603 c-Myc-regulated members of the miR-17~92 and miR-106a~363 clusters inhibit trophoblast differentiation by repressing GCM1 and CYP19A1.
23288173 HDAC9 promotes angiogenesis and transcriptionally represses the endothelial cell miR-17-92 cluster.
22995834 MiR-17-92 cluster microRNAs regulate the mRNA expression of their target genes in a dose-dependent manner.
22969266 Oncogenic microRNA 17-92 cluster is regulated by epithelial cell adhesion molecule and could be a potential therapeutic target in retinoblastoma.
22731656 Overexpression of miR-17-92 cluster accelerates cell proliferation.
22665768 results reveal a temporal expression pattern of miR-17-92 by antigen-specific CD8(+) T cells during viral infection, the precise control of which is critical to the effector expansion and memory differentiation of CD8(+) T cells
22451425 Imbalanced miR-17-92 expression, also mediated by p53, directly transforms the hematopoietic compartment.
22383169 Upreg'n of miR-17-92 cluster was seen in MYC-amplified AS compared to AS lacking MYC amplification and controls. Moreover, MYC-amplified ASs were associated with a significantly lower expression of THBS1 than AS without MYC amplification or controls.
22343732 High miR-17-92 is associated with chronic lymphocytic leukemia.
22116552 inhibition of miR-17 approximately 92 expression suppressed the PI3K/AKT pathway and inhibited tumor growth in a xenograft MCL mouse model
22024720 members of the oncomir miR-17-92 cluster were upregulated, but themiR-125b/miR-99a/let-7c, miR-106b/miR-93/miR-25 and miR-212/miR-132 clusters are also coordinately regulated either by stromal cell contact alone or by CD154
22022595 The network involving miR-17-92 exhibits high noise sensitivity due to a positive feedback loop and also maintains resistance to noise from a negative feedback loop.
21897363 Upon macrophage differentiation PU.1 represses the miR-17-92 cluster promoter by an Egr-2/Jarid1b-mediated H3K4 demethylation mechanism whose deregulation may contribute to leukaemic states.
21892160 We demonstrate that haploinsufficiency of miR-17 approximately 92 is responsible for skeletal and growth developmental abnormalities.
21796614 study demonstrates that the MYCN-induced downregulation of Dickkopf-3 (DKK3) results from direct upregulation of miR-17-92 components effecting both DKK3 mRNA stability
21664042 the Myc-inducible miR-17-92 cluster miRNAs contribute to tumorigenesis and poor prognosis in multiple myeloma
20305691 miR-17-92 and its target CTGF mediate effects of differentiation-promoting treatment on glioblastoma cells through multiple regulatory pathways.
20300951 Auroroa kinase A induces miR-17-92 cluster through regulation of E2F1 transcription factor.
20167088 The type-2-skewing tumor microenvironment induces the down-regulation of miR-17-92 expression in T cells, thereby diminishing the persistence of tumor-specific T cells and tumor control.
19696742 p53-mediated repression of miR-17-92 expression likely has an important function in hypoxia-induced apoptosis
19597473 miR-17-92 overexpression may serve as a fine-tuning influence to counterbalance the generation of DNA damage in RB-inactivated SCLC cells.

AA Sequence

MFCHVDVKISSKRYTWTKLPLNVPKLVLIYLQSHFVLFFFSMCQSIWERPAIGRATTSSASWMVGYDCLL      1 - 70
//

Text Mined References (63)

PMID Year Title
26837962 miR-17-92 host gene, uderexpressed in gastric cancer and its expression was negatively correlated with the metastasis.
26545119 2015 Kaposi's Sarcoma-Associated Herpesvirus (KSHV) Induces the Oncogenic miR-17-92 Cluster and Down-Regulates TGF-? Signaling.
26360630 2015 Expanding the phenotype of feingold syndrome-2.
26233958 2015 MiR-17-92 cluster promotes hepatocarcinogenesis.
25887381 2015 The miR-17-92 cluster counteracts quiescence and chemoresistance in a distinct subpopulation of pancreatic cancer stem cells.
25870038 2015 Functional interactions among members of the miR-17-92 cluster in lymphocyte development, differentiation and malignant transformation.
25732734 2015 WEE1 is a validated target of the microRNA miR-17-92 cluster in leukemia.
25634356 2015 The High Expression of the microRNA 17-92 Cluster and its Paralogs, and the Downregulation of the Target Gene PTEN, Is Associated with Primary Cutaneous B-Cell Lymphoma Progression.
25415674 2014 Association of plasma MiR-17-92 with dyslipidemia in patients with coronary artery disease.
25359779 2014 STAT3 inhibition suppresses proliferation of retinoblastoma through down-regulation of positive feedback loop of STAT3/miR-17-92 clusters.
25239565 2014 miR-17-92 cluster promotes cholangiocarcinoma growth: evidence for PTEN as downstream target and IL-6/Stat3 as upstream activator.
25140305 2014 The antileukemia activity of natural product HQ17(3) is possibly associated with downregulation of miR-17-92 cluster.
24645838 2014 Upregulation of microRNA-17-92 cluster associates with tumor progression and prognosis in osteosarcoma.
24625819 2014 Macro advances in microRNAs and myocardial regeneration.
24583285 2014 Toxoplasma gondii inhibits apoptosis via a novel STAT3-miR-17-92-Bim pathway in macrophages.
24469837 2014 PGE2-driven expression of c-Myc and oncomiR-17-92 contributes to apoptosis resistance in NSCLC.
24378993 2014 Crosstalk between TGF-?/Smad3 and BMP/BMPR2 signaling pathways via miR-17-92 cluster in carotid artery restenosis.
24305714 2014 High-throughput microRNA profiling of pediatric high-grade gliomas.
24280866 2014 Differential expression of miR-17~92 identifies BCL2 as a therapeutic target in BCR-ABL-positive B-lineage acute lymphoblastic leukemia.
24169826 2013 The Myc-miR-17-92 axis amplifies B-cell receptor signaling via inhibition of ITIM proteins: a novel lymphomagenic feed-forward loop.
24145352 2013 Silencing of the miR-17~92 cluster family inhibits medulloblastoma progression.
24068957 2013 MicroRNA-17-92, a direct Ap-2? transcriptional target, modulates T-box factor activity in orofacial clefting.
23921550 2013 MicroRNA-17~92 plays a causative role in lymphomagenesis by coordinating multiple oncogenic pathways.
23858035 2013 microRNA-17-92 regulates IL-10 production by regulatory T cells and control of experimental autoimmune encephalomyelitis.
23825564 2013 MicroRNA profiling of salivary adenoid cystic carcinoma: association of miR-17-92 upregulation with poor outcome.
23759744 2013 miR-17~92 miRNA cluster promotes kidney cyst growth in polycystic kidney disease.
23551855 2013 Role of microRNA in the pathogenesis of malignant lymphoma.
23550645 2013 mir-17-92: a polycistronic oncomir with pleiotropic functions.
23546593 2013 Expression and significance of PTEN and miR-92 in hepatocellular carcinoma.
23532756 2013 c-Myc-mediated overexpression of miR-17-92 suppresses replication of hepatitis B virus in human hepatoma cells.
23438603 2013 The c-Myc-regulated microRNA-17~92 (miR-17~92) and miR-106a~363 clusters target hCYP19A1 and hGCM1 to inhibit human trophoblast differentiation.
23288173 2013 Histone deacetylase 9 promotes angiogenesis by targeting the antiangiogenic microRNA-17-92 cluster in endothelial cells.
22995834 2012 Dose-dependent differential mRNA target selection and regulation by let-7a-7f and miR-17-92 cluster microRNAs.
22969266 2012 Oncogenic microRNA 17-92 cluster is regulated by epithelial cell adhesion molecule and could be a potential therapeutic target in retinoblastoma.
22731656 2012 MicroRNA 17-92 expressed by a transposone-based vector changes expression level of cell-cycle-related genes.
22665768 2012 Temporal expression of microRNA cluster miR-17-92 regulates effector and memory CD8+ T-cell differentiation.
22451425 2012 The miR-17-92 cluster expands multipotent hematopoietic progenitors whereas imbalanced expression of its individual oncogenic miRNAs promotes leukemia in mice.
22383169 2012 The miR-17-92 cluster and its target THBS1 are differentially expressed in angiosarcomas dependent on MYC amplification.
22343732 2012 The miR-17?92 family regulates the response to Toll-like receptor 9 triggering of CLL cells with unmutated IGHV genes.
22116552 2012 The miRNA-17?92 cluster mediates chemoresistance and enhances tumor growth in mantle cell lymphoma via PI3K/AKT pathway activation.
22024720 2012 Stromal cells and CD40 ligand (CD154) alter the miRNome and induce miRNA clusters including, miR-125b/miR-99a/let-7c and miR-17-92 in chronic lymphocytic leukaemia.
22022595 2011 MicroRNA-mediated positive feedback loop and optimized bistable switch in a cancer network Involving miR-17-92.
21897363 2011 Epigenetic silencing of the oncogenic miR-17-92 cluster during PU.1-directed macrophage differentiation.
21892160 2011 Germline deletion of the miR-17?92 cluster causes skeletal and growth defects in humans.
21796614 2012 Dickkopf-3 is regulated by the MYCN-induced miR-17-92 cluster in neuroblastoma.
21664042 2011 miR-17-92 cluster microRNAs confers tumorigenicity in multiple myeloma.
20305691 2010 De-repression of CTGF via the miR-17-92 cluster upon differentiation of human glioblastoma spheroid cultures.
20300951 2010 Aurora kinase A induces miR-17-92 cluster through regulation of E2F1 transcription factor.
20167088 2010 miR-17-92 expression in differentiated T cells - implications for cancer immunotherapy.
20008935 2009 miR-19 is a key oncogenic component of mir-17-92.
19696742 2009 Repression of the miR-17-92 cluster by p53 has an important function in hypoxia-induced apoptosis.
19597473 2009 Counterbalance between RB inactivation and miR-17-92 overexpression in reactive oxygen species and DNA damage induction in lung cancers.
17210683 2007 Role for amplification and expression of glypican-5 in rhabdomyosarcoma.
16266980 2005 A polycistronic microRNA cluster, miR-17-92, is overexpressed in human lung cancers and enhances cell proliferation.
16077067 2005 Studies define role of microRNA in cancer.
15944709 2005 c-Myc-regulated microRNAs modulate E2F1 expression.
15944707 2005 A microRNA polycistron as a potential human oncogene.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15126345 2004 Identification and characterization of a novel gene, C13orf25, as a target for 13q31-q32 amplification in malignant lymphoma.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11991713 2002 An evaluation of the assembly of an approximately 15-Mb region on human chromosome 13q32-q33 linked to bipolar disorder and schizophrenia.