Property Summary

NCBI Gene PubMed Count 20
PubMed Score 29.35
PubTator Score 20.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
gastric cancer 1.400 3.2e-04
hepatocellular carcinoma 1.700 1.0e-06
pancreatic cancer 1.600 2.0e-03
esophageal adenocarcinoma 1.100 1.8e-02
cutaneous lupus erythematosus 1.100 2.8e-02
psoriasis 1.500 3.4e-04
osteosarcoma -2.412 1.7e-06
tuberculosis and treatment for 3 months -1.500 1.5e-04
lung cancer 1.600 1.2e-04
group 3 medulloblastoma 1.300 2.3e-04
primary Sjogren syndrome 1.300 2.9e-05
pancreatic carcinoma 1.600 2.0e-03
nasopharyngeal carcinoma 1.200 7.0e-04
acute myeloid leukemia -4.000 1.2e-02
ovarian cancer -1.800 5.7e-06

 MGI Phenotype (1)

Protein-protein Interaction (5)

Gene RIF (5)

PMID Text
23186306 By RNA knockdown, we identified secreted and lysosome targeted MINPP1 (multiple inositol-polyphosphate phosphatase 1), the mammalian 3-phytase, to be essentially involved both in extracellular and in lysosomal InsP6 dephosphorylation
21071540 Observational study of gene-disease association. (HuGE Navigator)
20304771 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19460752 Knockdown of multiple inositol-polyphosphate phosphatase 1 (MINPP1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLRAPGCLLRTSVAPAAALAAALLSSLARCSLLEPRDPVASSLSPYFGTKTRYEDVNPVLLSGPEAPWRD      1 - 70
PELLEGTCTPVQLVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYAD     71 - 140
WMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLITSSKHRCMDSSAAFLQGLWQHYHPGLPPPD    141 - 210
VADMEFGPPTVNDKLMRFFDHCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADL    211 - 280
IQVAFFTCSFDLAIKGVKSPWCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKA    281 - 350
VEQKQRSQPISSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKKQMHRKFRSGLIVPYASNLIFVLY    351 - 420
HCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDLKNHYKDILQSCQTSEECELARANSTSDEL       421 - 487
//

Text Mined References (24)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186306 2013 Tumour cells can employ extracellular Ins(1,2,3,4,5,6)P(6) and multiple inositol-polyphosphate phosphatase 1 (MINPP1) dephosphorylation to improve their proliferation.
21269460 2011 Initial characterization of the human central proteome.
21071540 2011 Validation of genome-wide prostate cancer associations in men of African descent.
20304771 2010 A meta-analysis of four genome-wide association studies of survival to age 90 years or older: the Cohorts for Heart and Aging Research in Genomic Epidemiology Consortium.
18413611 2008 Dephosphorylation of 2,3-bisphosphoglycerate by MIPP expands the regulatory capacity of the Rapoport-Luebering glycolytic shunt.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16759730 2006 Avian multiple inositol polyphosphate phosphatase is an active phytase that can be engineered to help ameliorate the planet's "phosphate crisis".
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11297621 2001 Somatic mutation and germline variants of MINPP1, a phosphatase gene located in proximity to PTEN on 10q23.3, in follicular thyroid carcinomas.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
10938126 2000 Targeted deletion of Minpp1 provides new insight into the activity of multiple inositol polyphosphate phosphatase in vivo.
10087200 1999 Multiple inositol polyphosphate phosphatase: evolution as a distinct group within the histidine phosphatase family and chromosomal localization of the human and mouse genes to chromosomes 10q23 and 19.
9923613 1999 The human and rat forms of multiple inositol polyphosphate phosphatase: functional homology with a histidine acid phosphatase up-regulated during endochondral ossification.
9472008 1998 HiPER1, a phosphatase of the endoplasmic reticulum with a role in chondrocyte maturation.