Property Summary

NCBI Gene PubMed Count 26
PubMed Score 112.29
PubTator Score 158.47

Knowledge Summary

Patent (26,509)

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -4.200 2.8e-06
osteosarcoma -1.611 4.3e-06
group 3 medulloblastoma -1.500 8.0e-04
astrocytoma 2.300 4.6e-03
medulloblastoma, large-cell -1.800 2.6e-05
pancreatic ductal adenocarcinoma liver m... 1.243 9.0e-03
atypical teratoid/rhabdoid tumor -1.100 7.2e-08
ovarian cancer 1.200 2.4e-04

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (9)

PMID Text
25747578 MINK plays a functional role in the IRES-mediated translation of EV71 viral RNA and may provide a potential target for the development of specific antiviral strategies against EV71 infection
22665485 Misshapen-like kinase 1 (MINK1) is a novel component of striatin-interacting phosphatase and kinase (STRIPAK) and is required for the completion of cytokinesis.
22037766 MINK1 interacts with and phosphorylates PRICKLE1 and PRICKLE2.
21048137 MINK interaction with Rap2 plays a critical role in maintaining the morphological integrity of dendrites and synaptic transmission.
18752142 Observational study of gene-disease association. (HuGE Navigator)
17165161 Observational study of gene-disease association. (HuGE Navigator)
16760206 Observational study of gene-disease association. (HuGE Navigator)
15469942 results suggest that human Misshapen/NIKs-related kinase beta (hMINK beta) plays an important role in cytoskeleton reorganization, cell adhesion, and cell motility(hMINKbeta)
12668260 Analysis of the coding region of the NIK gene in progressive supranuclear palsy (PSP) patients through single strand conformation polymorphism and direct sequencing does not support a pathogenic role of the NIK gene in PSP.

AA Sequence

MGDPAPARSLDDIDLSALRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKQEI      1 - 70
NMLKKYSHHRNIATYYGAFIKKSPPGNDDQLWLVMEFCGAGSVTDLVKNTKGNALKEDCIAYICREILRG     71 - 140
LAHLHAHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATY    141 - 210
DYRSDIWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFIDFIDTCLIKTYLSRPPT    211 - 280
EQLLKFPFIRDQPTERQVRIQLKDHIDRSRKKRGEKEETEYEYSGSEEEDDSHGEEGEPSSIMNVPGEST    281 - 350
LRREFLRLQQENKSNSEALKQQQQLQQQQQRDPEAHIKHLLHQRQRRIEEQKEERRRVEEQQRREREQRK    351 - 420
LQEKEQQRRLEDMQALRREEERRQAEREQEYKRKQLEEQRQSERLQRQLQQEHAYLKSLQQQQQQQQLQK    421 - 490
QQQQQLLPGDRKPLYHYGRGMNPADKPAWAREVEERTRMNKQQNSPLAKSKPGSTGPEPPIPQASPGPPG    491 - 560
PLSQTPPMQRPVEPQEGPHKSLVAHRVPLKPYAAPVPRSQSLQDQPTRNLAAFPASHDPDPAIPAPTATP    561 - 630
SARGAVIRQNSDPTSEGPGPSPNPPAWVRPDNEAPPKVPQRTSSIATALNTSGAGGSRPAQAVRARPRSN    631 - 700
SAWQIYLQRRAERGTPKPPGPPAQPPGPPNASSNPDLRRSDPGWERSDSVLPASHGHLPQAGSLERNRVG    701 - 770
VSSKPDSSPVLSPGNKAKPDDHRSRPGRPADFVLLKERTLDEAPRPPKKAMDYSSSSEEVESSEDDEEEG    771 - 840
EGGPAEGSRDTPGGRSDGDTDSVSTMVVHDVEEITGTQPPYGGGTMVVQRTPEEERNLLHADSNGYTNLP    841 - 910
DVVQPSHSPTENSKGQSPPSKDGSGDYQSRGLVKAPGKSSFTMFVDLGIYQPGGSGDSIPITALVGGEGT    911 - 980
RLDQLQYDVRKGSVVNVNPTNTRAHSETPEIRKYKKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGK    981 - 1050
VYGLIGRRRFQQMDVLEGLNLLITISGKRNKLRVYYLSWLRNKILHNDPEVEKKQGWTTVGDMEGCGHYR   1051 - 1120
VVKYERIKFLVIALKSSVEVYAWAPKPYHKFMAFKSFADLPHRPLLVDLTVEEGQRLKVIYGSSAGFHAV   1121 - 1190
DVDSGNSYDIYIPVHIQSQITPHAIIFLPNTDGMEMLLCYEDEGVYVNTYGRIIKDVVLQWGEMPTSVAY   1191 - 1260
ICSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVYFMTLNRNCIM   1261 - 1330
NW                                                                       1331 - 1332
//

Text Mined References (42)

PMID Year Title
26496226 2015 Immediate-early response 5 (IER5) interacts with protein phosphatase 2A and regulates the phosphorylation of ribosomal protein S6 kinase and heat shock factor 1.
25816751 2015 HSF1 transcriptional activity is modulated by IER5 and PP2A/B55.
25747578 2015 The role of Misshapen NCK-related kinase (MINK), a novel Ste20 family kinase, in the IRES-mediated protein translation of human enterovirus 71.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22797597 2012 Rap2A links intestinal cell polarity to brush border formation.
22665485 2012 Misshapen-like kinase 1 (MINK1) is a novel component of striatin-interacting phosphatase and kinase (STRIPAK) and is required for the completion of cytokinesis.
22037766 2012 Mink1 regulates ?-catenin-independent Wnt signaling via Prickle phosphorylation.
21690388 2011 Smad inhibition by the Ste20 kinase Misshapen.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21048137 2010 MINK and TNIK differentially act on Rap2-mediated signal transduction to regulate neuronal structure and AMPA receptor function.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18930710 2008 MINK is a Rap2 effector for phosphorylation of the postsynaptic scaffold protein TANC1.
18752142 2008 Molecular genetic analysis of long QT syndrome in Norway indicating a high prevalence of heterozygous mutation carriers.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18088087 2008 Phosphoproteome of resting human platelets.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17165161 2006 MinK gene polymorphism in the pathogenesis of lone atrial fibrillation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16760206 2006 Analysis of minK and eNOS genes as candidate loci for predisposition to non-valvular atrial fibrillation.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16337592 2005 Involvement of MINK, a Ste20 family kinase, in Ras oncogene-induced growth arrest in human ovarian surface epithelial cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15469942 2004 Identification and functional characterization of a novel human misshapen/Nck interacting kinase-related kinase, hMINK beta.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12668260 2003 Mutational study of the nuclear factor kappa B inducing kinase gene in patients with progressive supranuclear palsy.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
12087176 2002 Overlapping of MINK and CHRNE gene loci in the course of mammalian evolution.
10708748 2000 Molecular cloning of MINK, a novel member of mammalian GCK family kinases, which is up-regulated during postnatal mouse cerebral development.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.