Property Summary

NCBI Gene PubMed Count 30
PubMed Score 28.34
PubTator Score 49.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
psoriasis -1.400 1.7e-04
osteosarcoma 1.845 1.3e-04
posterior fossa group B ependymoma 2.100 2.5e-14
group 3 medulloblastoma 1.800 1.2e-05
medulloblastoma, large-cell 2.100 1.1e-05
lung cancer 1.400 2.7e-03
active Crohn's disease 1.025 1.6e-02
Breast cancer -2.100 3.9e-02
pilocytic astrocytoma 1.100 2.7e-05
acute myeloid leukemia -1.400 2.8e-03
ovarian cancer 1.200 2.0e-03

Gene RIF (22)

PMID Text
26608785 Histone modifier genes (JMJD1C, RREB1, MINA, KDM7A) alter conotruncal heart phenotypes in 22q11.2 deletion syndrome.
26293673 Data suggest that mineral dust-induced gene protein (mdig) accomplishes its functions on chromatin, DNA repair and cell growth through interacting with the partner proteins.
25851349 in lung cancer tissues, upregulation of mdig expression accompanies with the downregulation of p27(KIP1) expression and in bronchial stump
25282476 Mina: a Th2 response regulator meets TGFbeta.
24522517 Mina53 can be used as a marker for pancreatic cancer
24505346 Increased expression of mdig in cancer tissues.
24434654 results show mdig induction by arsenic is partially dependent on the JNK and STAT3 signaling pathways.
24337011 mina53 expression was gradually elevated during gastric carcinogenesis, and the overexpression of mina53 was correlated with different clinicopathological features between diffuse-type gastric carcinoma and intestinal-type gastric carcinoma cases.
24309373 these data suggest that an increased expression of mdig is an important prognostic factor for poorer survival time of the breast cancer patients.
23965803 Results imply that mdig is involved in the regulation of H3K9me3 to influence the heterochromatin structure of the genome and the expression of genes important for cell growth or transformation.
21631300 The single nucleotide polymorphism of the Mina gene is associated with the development of asthma in Chinese Han children.
19914733 favorable prognostic marker in early stage lung cancer
19756735 Mina53 plays an important role in carcinogenesis and may be a target for cancer prevention.
19502796 The MINA protein alters histone H3 methylation contributes to the initiation or development of the human lung cancer.
18629780 Mina53 was overexpressed in gastric carcinoma and associated with tumor proliferation and antioncogene inactivation.
17803656 Mina53 is overexpressed in renal cell carcinoma tissue from patients with poor prognostic factors, suggesting that Mina53 overexpression is one of the factors for poor prognosis in renal cell carcinoma.
17786344 Increased expression of Mina53 is associated with lymphoma
15897898 The expression of mineral dust induced mRNA was detected in alveolar macrophages from coal miners but not from normal subjects.
15819408 Data suggests NO52 protein (MYC induced nuclear antigen) is directly involved in ribosome biogenesis, most likely during the assembly process of preribosomal particles.
15534111 Mina53 may have a role in progression of esophageal squamous cell carcinoma
14695334 the elevated expression of Mina53 is a characteristic feature in colon cancer
12091391 role in cell division

AA Sequence

MPKKAKPTGSGKEEGPAPCKQMKLEAAGGPSALNFDSPSSLFESLISPIKTETFFKEFWEQKPLLIQRDD      1 - 70
PALATYYGSLFKLTDLKSLCSRGMYYGRDVNVCRCVNGKKKVLNKDGKAHFLQLRKDFDQKRATIQFHQP     71 - 140
QRFKDELWRIQEKLECYFGSLVGSNVYITPAGSQGLPPHYDDVEVFILQLEGEKHWRLYHPTVPLAREYS    141 - 210
VEAEERIGRPVHEFMLKPGDLLYFPRGTIHQADTPAGLAHSTHVTISTYQNNSWGDFLLDTISGLVFDTA    211 - 280
KEDVELRTGIPRQLLLQVESTTVATRRLSGFLRTLADRLEGTKELLSSDMKKDFIMHRLPPYSAGDGAEL    281 - 350
STPGGKLPRLDSVVRLQFKDHIVLTVLPDQDQSDEAQEKMVYIYHSLKNSRETHMMGNEEETEFHGLRFP    351 - 420
LSHLDALKQIWNSPAISVKDLKLTTDEEKESLVLSLWTECLIQVV                             421 - 465
//

Text Mined References (38)

PMID Year Title
26608785 2015 Histone Modifier Genes Alter Conotruncal Heart Phenotypes in 22q11.2 Deletion Syndrome.
26293673 2015 The proteomic investigation reveals interaction of mdig protein with the machinery of DNA double-strand break repair.
25851349 2015 Mdig, a lung cancer-associated gene, regulates cell cycle progression through p27(KIP1).
25416956 2014 A proteome-scale map of the human interactome network.
25282476 2014 Mina: a Th2 response regulator meets TGF?.
24522517 2014 Potential effects of Mina53 on tumor growth in human pancreatic cancer.
24505346 2014 Paradoxical roles of mineral dust induced gene on cell proliferation and migration/invasion.
24434654 2014 Carcinogenic metalloid arsenic induces expression of mdig oncogene through JNK and STAT3 activation.
24337011 2014 Mina53, a novel molecular marker for the diagnosis and prognosis of gastric adenocarcinoma.
24309373 2014 Increased expression of mdig predicts poorer survival of the breast cancer patients.
23965803 2013 Mdig de-represses H19 large intergenic non-coding RNA (lincRNA) by down-regulating H3K9me3 and heterochromatin.
23103944 2012 Oxygenase-catalyzed ribosome hydroxylation occurs in prokaryotes and humans.
21631300 Associations of the single-nucleotide polymorphisms of the Mina gene with the development of asthma in Chinese Han children: a case-control study.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19914733 2010 Expression of Mina53, a novel c-Myc target gene, is a favorable prognostic marker in early stage lung cancer.
19756735 2010 Mina53, a novel c-Myc target gene, is frequently expressed in lung cancers and exerts oncogenic property in NIH/3T3 cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19502796 2009 Lung cancer-associated JmjC domain protein mdig suppresses formation of tri-methyl lysine 9 of histone H3.
18629780 Expression of Mina53 and its significance in gastric carcinoma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17803656 2007 Overexpression of the myc target gene Mina53 in advanced renal cell carcinoma.
17786344 2007 Expression of Myc target gene mina53 in subtypes of human lymphoma.
17317935 2006 Immunohistochemical expression of Mina53 and Ki67 proteins in human primary gingival squamous cell carcinoma.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15897898 2005 The Human mineral dust-induced gene, mdig, is a cell growth regulating gene associated with lung cancer.
15819408 2005 Protein NO52--a constitutive nucleolar component sharing high sequence homologies to protein NO66.
15534111 2004 Mina53 as a potential prognostic factor for esophageal squamous cell carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14742713 2004 NO66, a highly conserved dual location protein in the nucleolus and in a special type of synchronously replicating chromatin.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14695334 2004 Increased expression of a Myc target gene Mina53 in human colon cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12091391 2002 A novel myc target gene, mina53, that is involved in cell proliferation.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.