Property Summary

NCBI Gene PubMed Count 13
PubMed Score 16.09
PubTator Score 11.02

Knowledge Summary


No data available


  Disease (1)


  Differential Expression (4)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... -1.100 1.2e-02
malignant mesothelioma 1.500 2.8e-06
osteosarcoma -1.269 8.4e-07
psoriasis 1.100 2.9e-04

Gene RIF (10)

AA Sequence

LSGTSSPFHPASPMQMLPPTPTWSVPQVPRPHVPRQKP                                    351 - 388

Text Mined References (18)

PMID Year Title